CAZyme Information: MGYG000003293_00252

Basic Information

• Species: CAG-110 sp900544405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900544405
• CAZyme ID: MGYG000003293_00252
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	MGYG000003293_14|CGC1	94921.1	6.6062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003293	2030729	MAG	Mongolia	Asia

• Gene Location: Start: 3019; End: 5559 Strand: -

Full Sequence      

MNAIRLKTEHLINPIGVDFSAPRLSWNCDGGVKQTAYQILAADEAGTVLWDSGRVESSAM
CAQWGGAPVPPKTKVLWNVRLWDETDSVGDWAEDTFETGIDHWKAKWITGNYRVHRKKRY
PVDCFRKKFSLSRAKKARLYITACGLYEAKLNGLRIGDFILAPGITDYRKRVQYQTYDVT
DLLQSGENTLTVQLADGWYRGSCGAWGLKNQYGTEIKFLAQLEITDEKGHVQVIPTDESW
EWSNDGPIRFADNKDGEVFDARMAPSYAGKAKVTSHSVTPSASNNVPVTEHERLKPVCIT
TPSGKTVLDFGQNIAGYAEFVVTAHAGQTIKLRFGELLDKNGEFTQKNIQCSSKRITTPL
QQVIYTCKEGENHYKTSFAIFGFQYVLVETEVPVSAGDFTTIAVYSDMERTGFFESSNPL
LDKLVENTVWSAKNNHADLPTDCPTRERHGWTGDAQIFCPTASYLFDYLPFAEKYLNDVY
DWQTKNGCLPQIAPEGGTDFYMRAMNGSVGWADAGVLMPYVLWKQYGDRSVLKKYLPGMR
RYAKFMQNRCGKWYPTAKRTGLHGKHKRYLSNYGQAYGEWAEPESVHHMSWKDCAVPHPE
VATAYTAHVMDCMAEIEAALGNEAESSAYREFAAGCRRSYQALRRTAAYPLDTDRQAQLV
RPLAFQLLDEAQTEYAQKRLLTALEHFSWCVGTGFLSTPLILDVLTDIDLESAYRLLENE
EIPGWLSMPKNGATTIWEAWEGPNSKSGGIGSLNHYSKGAVVAWLFNTMCGIRVDGENHF
VITPHPGGHFTHAKAVYDSVYGRVESGWEKTPDGWKYTVTVPANCTAELYLPEKPPVTLE
SGTHTV

Enzyme Prediction     

No EC number prediction in MGYG000003293_00252.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	300	831	1.8e-141	0.9940476190476191
CBM67	105	265	7.5e-30	0.8409090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.62e-86	409	769	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.79e-53	133	292	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.71e-19	299	405	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.08e-17	771	844	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25263.1	0.0	1	842	1	840
QFJ55302.1	0.0	1	844	1	861
QUC03017.1	0.0	1	844	1	878
ADP81465.1	1.35e-264	1	844	1	858
QZN73695.1	4.43e-244	1	844	2	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	7.97e-121	1	836	1	999	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	4.75e-113	6	833	35	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	7.64e-110	9	844	10	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	3.35e-120	1	836	1	999	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.12e-116	8	832	41	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.75e-107	9	832	38	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	3.63e-71	13	831	42	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003293_00252.