CAZyme Information: MGYG000003293_00882

Basic Information

• Species: CAG-110 sp900544405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900544405
• CAZyme ID: MGYG000003293_00882
• CAZy Family: GH66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1758	MGYG000003293_58|CGC1	192095.23	4.2095

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003293	2030729	MAG	Mongolia	Asia

• Gene Location: Start: 7340; End: 12616 Strand: +

Full Sequence      

MKNGFYRLIALLLCAVVLLGLGSPAAAVSQAVPSLTGLSADKAMYAPGETATFTVDIDNS
GGEAWNGTLYFQIYHLENAVAALNIQVSVPADAKTTCTAQWVLPEQDFTGYLVKAYFNEE
TWVTTGLDCSSDFTVFPRYGYVSDYTADTAQAQAEIRALSDRYHINAYQLYDWMWRHETL
IQRSGTEAADSWQDLFGRTISVQTIRDYISAIHSRNGAAMAYVMSYAAREGYTDKGIDPS
AGLFTDQGHESQLNVDFGDGATYLWLFDPANEIWQQTMTAQYTDAVNTLGFDGLQIDQMG
QRNNVYDYRGQKVYLEDTFSDFVNAAKAALTANNAEKDAVTFNIVDGTVNGWAMDDVTRN
ADTDFNFSEIWWLSNSYNDIKNYIEQVRSQSGGKALVLAAYMNYNDNCGTVYEAENAALD
GAGVNTDHTGYTGSGFVDGFAEAGDSVTFTVTAPEDGLYAFVFRYANAGSGATRKVYVDG
TILDQVSFKTLSSWDDWAQDANCSTYLTAGTHTVRLSYDTGCAGAINLDSLTLGTFDENS
VRLADAAFAASGAYHIELGAGQGQGTMLSHEYYPMNAKVMDSALQGAMERHYDFITAYEN
LLYAPEIAYADTGTQYLTIANEAVSGSGEAGKIWYIARQSEDYSILHLINLTGEDDTQWR
NATAAPATKENLAVRYYLGENAAVSGVYLASPDRDGCQSTSLSYTTGVDEKGSYVAFTVP
SLEYWDMIYIRRSNGSDTVFEAENALKTGVAVDTDHAGYTGTGFVDQFAEQGDSVGFTVS
VPENGAYTLRLRYANGSGSEAARSVIVDGTYANKAYFVAQSDWDTWSTAEVGIDLPAGVH
TVVLYYGDYEYGAINLDSMELTSRSETTRSLYLNNWKNLVAIWQDSFVNQATAVNADGPG
LYELRYYDGTASGNYNTNLIRNYSTFLRDETAQVSYTTGSKFSSSGYFDQGGVLVNTYRS
YDGAALPVTLSKQYAFVPNEQFLVVRYDLTNPGDSARTVDLLDMLHIRNDSGANVSAAYS
AGDHTVRYDLSGAGLPYIAHGVLSTEALSGYQVADDTQSTGTAGSPWHSFNANGSLNGNG
SVTCADISSGLSAAVTLAPGQTQTLYFYVAAAGTEDALNAAIAKVTNASGDHWMETTRSA
YAAWLAEGRTPELGEDKLNDAYKSISVFMKQSIVPGTNADGNVRFAAFPATTNPSAYSYK
VWARDSAVTAMGLDATGHLREAENYWTWLADRQITTDEGSWKKPGTFWTCYWVWDNGPVS
FVEPEFDSIGMFLVGAYRHYEQLTGSAKTAFLEKIWPAYRRSADYVLNNITDAGFGPADC
SIWEEQNEYNAFTQALYVAGLDAAQHMAAAKGLQDVADLYNGGASTIRTAILRDDTASPK
GLWNTESQRFNRAVNLDGTANTTYDSSSDVLISYGVVDAESSRAKSHIDGILENLGHDTY
GVARYENDGFYHRMSWDPGGNEAYEDEPSWPQMAMWIAMYELQSGYKAYRTNAYRRLQWF
VDRTAEGYMPQGECFSNITRKPHLSTMCEPITGAAYLMAALAYDGQFDMRIYGPQVNAGA
YRTVTMHDGCVGDWTQWAGVPYYTDPVGDASGSYDLKRVYLANDGGNVYLRLDLADWTLP
GYQAEDVFAVQIYADGGTGTAMTTTMTGGEMTHSMRSMVMRSSDSGDYCRYTAGSDGWTL
AGTVDSVLVPQWEVNSGRMELAIPFASLGNGALAAGDWTNLHIVLLQKNGADWVEADAFD
AHYRITADGSEWLKGNFQ

Enzyme Prediction     

EC	2.4.1.248

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH66	38	422	1.5e-112	0.670863309352518
GH66	526	731	2.7e-62	0.3579136690647482
GH15	1192	1509	1.3e-36	0.8227146814404432
CBM35	412	533	2e-36	0.9915966386554622
CBM35	740	861	7.4e-35	0.9915966386554622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13199	Glyco_hydro_66	4.37e-151	41	729	2	557	Glycosyl hydrolase family 66. This family is a set of glycosyl hydrolase enzymes including cycloisomaltooligosaccharide glucanotransferase (EC:2.4.1.-) and dextranase (EC:3.2.1.11) activities.
cd14745	GH66	2.00e-99	135	598	1	331	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.
cd04083	CBM35_Lmo2446-like	1.04e-40	410	533	1	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04083	CBM35_Lmo2446-like	3.30e-39	738	861	1	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04082	CBM35_pectate_lyase-like	2.31e-29	410	533	1	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH30053.1	0.0	34	1756	32	1819
AUS97990.1	1.69e-296	41	859	45	866
BAA13595.1	2.75e-282	41	861	42	862
QNK58819.1	2.45e-281	41	861	46	866
BAA09604.1	4.73e-279	7	861	12	870

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WNK_A	3.54e-244	41	730	33	721	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNL_A	3.68e-243	41	730	14	702	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNM_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNP_A	3.99e-242	41	730	14	702	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNP_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
5X7G_A	3.23e-236	41	730	32	720	CrystalStructure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase [Paenibacillus sp. 598K],5X7H_A Crystal Structure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase complexed with cycloisomaltoheptaose [Paenibacillus sp. 598K]
5AXG_A	2.26e-85	41	732	50	610	Crystalstructure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223],5AXG_B Crystal structure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70873	5.50e-283	41	861	42	862	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 GN=cit PE=3 SV=1
P94286	9.47e-280	7	861	12	870	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1
Q59979	2.57e-26	68	744	2	611	Dextranase OS=Streptococcus salivarius OX=1304 GN=dex PE=3 SV=1
Q54443	3.59e-26	34	738	104	740	Dextranase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=dexA PE=1 SV=2
P39653	1.31e-25	29	734	157	804	Dextranase OS=Streptococcus downei OX=1317 GN=dex PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000318	0.998890	0.000239	0.000196	0.000167	0.000152

TMHMM  Annotations     

start	end
5	27