CAZyme Information: MGYG000003294_00539

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_A
• CAZyme ID: MGYG000003294_00539
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		47289.55	8.9472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003294	2141670	MAG	Mongolia	Asia

• Gene Location: Start: 18; End: 1304 Strand: -

Full Sequence      

MHFRYSLLAASITCSLLALSVQPTISEAASASPQVASTPVANRTLPGRPDFSPTMPREIN
KKAVTQVQWKTAPAFDSPMMAVDTAPDSITILGPAEATQEQMIHFIKKHNAKPKLTCSVE
DIVRYYYQEAGREGIRPDVALCQAIKETGFFGYGGDVSPSQNNFCGLGATGNHEPGHSFA
TAQLGVRAHIQHLLAYTRSEKPSITIVDPRYWHVVRNRPDLHGKVFKWTGLNGAWAVPGK
NYGQEILSLWRQAQAPDASDAALDAGNRKVKSAPDEASSYIYRGIVWYNRGDYKTALRDF
SQALTFQPQSSEALYNHAITASKLNNPKLARKDYDVLLKTTPNLNQGWFNRGLLRFEAKD
YGGAIADMEQLLQIEARSADARNLIGVAHIQQKKYTDAWTDFQEAAAINSANMNVLANQF
IMEACLKK

Enzyme Prediction     

No EC number prediction in MGYG000003294_00539.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00006	TPR	3.52e-15	277	373	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	5.35e-14	311	405	1	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
COG0457	TPR	4.51e-12	241	424	93	283	Tetratricopeptide (TPR) repeat [General function prediction only].
pfam01832	Glucosaminidase	1.44e-11	125	189	3	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02917	PEP_TPR_lipo	1.13e-10	260	416	107	298	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84275.1	7.36e-202	34	427	25	418
AVO26228.1	9.35e-118	62	419	42	397
CCC73641.1	2.57e-117	62	419	41	396
AVO73547.1	2.57e-117	62	419	41	396
ALG42989.1	5.14e-117	62	419	41	396

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	1.07e-16	119	229	68	179	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000636	0.998356	0.000317	0.000308	0.000214	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003294_00539.