CAZyme Information: MGYG000003294_00924

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_A
• CAZyme ID: MGYG000003294_00924
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		64383.7	6.5059

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003294	2141670	MAG	Mongolia	Asia

• Gene Location: Start: 1225; End: 2943 Strand: -

Full Sequence      

MDHDALNWLSLADKFAAEGDPKGMRACARELWEMDADSMDGAAVMAEAALYSGEREEAQA
LVAEILSKKPKHLRGRMVKAGLAAVEFRLDEEIPLLQEIIAETERKRNALEPEDAYFGVL
THILKKARGWLADAEYLAARPDKAAQELLYRSELCEEPLEKAEMYSKYLFMRNYREQAIF
ESRAAAEAYEPMLAIAPYLHDTVKKQPDKKLRIGYLSPDFREHAVASFLEPLLKDYDGEH
FSVYCYSTGRPDHVTRKIRSCHVQWRDLRGRNPRTAARLIAEDQIDILMDMSGHTQGSCL
PIMAYRPAPVQLAGIGYMNTTGLSTVDYFLSDEVCLPTGEVTAEGFTEKILRLQHSHLCY
RPGFAREIPAAGTEAPCLRNGYVTFGSFNNFAKVTDETLLMWRSILDQVPDSRLVIKGKI
CSIPSGKAIVKDRLSRLGMNMARIELRPYSPDYLEQYRDIDIALDAMPYNGGLTTCEALY
MGVPVVSLRGRSHGARFGASILTNAGVRELVVENDLNYVRRAVQLGNSPELVGAYHSGLR
ANLLKSPLMDSKGYMHELQNGYRQIWKNFCTN

Enzyme Prediction     

No EC number prediction in MGYG000003294_00924.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	39	569	3.8e-108	0.6666666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3914	Spy	5.94e-90	115	566	150	615	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
pfam13844	Glyco_transf_41	2.03e-32	192	558	62	543	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
sd00008	TPR_YbbN	4.06e-06	12	149	8	128	C-terminal Tetratricopeptide repeat (TPR) region of YbbN and similar motifs. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. YbbN is a thioredoxin-like protein containing two tandem TPR repeats at the C-terminus, separated by two alpha helices. Its N-terminal thioredoxin-like domain is not a functional oxidoreductase. It functions in heat stress response and DNA synthesis as a chaperone or co-chaperone.
TIGR02917	PEP_TPR_lipo	2.55e-04	30	165	112	249	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL83943.1	1.23e-315	1	571	1	571
QNH53886.1	2.32e-262	4	572	14	583
AOH48026.1	2.03e-261	4	572	14	583
ANR71313.1	3.81e-261	4	572	14	583
AKT54951.1	9.29e-259	4	569	14	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	5.21e-61	195	570	147	520	Thermobaculumterrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
6Q4M_A	6.05e-30	197	571	224	711	Crystalstructure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
6IBO_A	8.09e-30	197	571	224	711	Catalyticdeficiency of O-GlcNAc transferase leads to X-linked intellectual disability [Homo sapiens]
5NPR_A	1.06e-29	197	571	218	705	Thehuman O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	1.07e-29	197	571	219	706	Thehuman O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O82039	6.21e-79	205	570	482	850	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
Q8RVB2	1.11e-76	205	570	482	850	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
Q96301	1.19e-75	205	570	477	845	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
Q6YZI0	1.41e-75	205	570	468	836	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1
Q8LP10	4.60e-75	205	570	454	819	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum OX=52518 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003294_00924.