CAZyme Information: MGYG000003294_01618

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Selenomonas_A
• CAZyme ID: MGYG000003294_01618
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		59987.7	4.9662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003294	2141670	MAG	Mongolia	Asia

• Gene Location: Start: 980; End: 2557 Strand: +

Full Sequence      

MERTQLRIVKAYQQVFSLWQQKKLVEAEQLLQNFWQQSSMKSLRGMLLMAYILRDRQKYV
SEVKVLEELLERFADSGEAKLLADAWSMLGSVLRRLGESELSVEAFKKSVELEPDKKQKL
VECSNALFSANAIDGVTAEYMQSLYALYRRLLADLAIEPYPVQDWQHEKIRVGYLSADLR
DHAVAQFVRPLFCQYDRERFRVYGYSLVRQPDDVTEALQQGCDTWRDVSDGSWAEIAQQI
RADEIDILVDLAGHSAENALPVFAYRPAPVQISGIGYFNSTGMQEMQGFLSDRYCSPEEY
SPYFTEKLLRLPQSHFCYQPFSKFPAVGQLPCLVKGYVTFGCFNNFAKVNDGMLLLWKEI
LQRVPDSHLLLKHSLLGTEEGLSYTCQRFERLGMPMERIEFRGLSKDYLEQYNDMDIALD
TSPYPGGLTTCEALYMGVPVVTLKGNRHGARFGYSFLANLGLQELVVEDAKGYVDIAVKI
AGDSELLSLLRANLRRMMQASPLMDGDAYMRAMESLYGQLYEESV

Enzyme Prediction     

No EC number prediction in MGYG000003294_01618.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	20	523	6.4e-114	0.64822695035461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3914	Spy	6.59e-103	89	523	148	617	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
pfam13844	Glyco_transf_41	2.63e-28	169	513	80	543	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
TIGR02917	PEP_TPR_lipo	3.46e-06	21	155	138	272	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
cd03807	GT4_WbnK-like	2.45e-04	390	517	241	361	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd04949	GT4_GtfA-like	4.33e-04	397	474	217	282	accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84160.1	9.82e-194	9	523	405	919
QNH55417.1	1.14e-128	60	525	96	567
ANR70172.1	9.61e-128	82	525	123	567
AOH48972.1	6.06e-126	51	525	84	567
AME03582.1	6.96e-122	51	525	84	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	6.66e-71	89	524	83	519	Thermobaculumterrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
2VSN_A	6.07e-33	170	509	206	548	Structureand topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
2JLB_A	2.77e-32	170	509	206	548	Xanthomonascampestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
6Q4M_A	6.86e-29	169	522	237	707	Crystalstructure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
5NPR_A	1.21e-28	169	522	231	701	Thehuman O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6YZI0	7.04e-73	103	521	408	832	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1
O82039	1.97e-72	172	521	490	846	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
Q8RVB2	2.69e-72	110	521	429	846	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
Q96301	3.87e-70	170	523	483	843	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
O82422	1.32e-68	111	521	416	832	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare OX=4513 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003294_01618.