CAZyme Information: MGYG000003296_01777

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA5905
• CAZyme ID: MGYG000003296_01777
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	MGYG000003296_561|CGC1	58806.34	5.0781

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003296	2196597	MAG	Mongolia	Asia

• Gene Location: Start: 1335; End: 2912 Strand: -

Full Sequence      

MLNILREPDDIRIVCEKDNEDCAVKTAIESGRLYVYVTATVSRPRFICLRWNYRVTEPTR
ILGDKWERSYGDMEWHALNGEIFMPWYFLANSGDTTVGCGVMTGANSFVSFQCDASGCTA
WFDVRCGGVGVRLDGRRLLAGVVVCQEYSGISAFSAARQFCRRMCEAPRLPAAPVYGSNN
WYYAYGKSSRSEVIRDAEMTAALAAGNTNRPFTVIDDGWSVAPCAGPWEPNEKFGDMAEI
SAAFKRIGVRPGIWIRPLRDKVLERQHPEWCLSRVNDGDANSGPSYCLDPTVPEVREYIR
ATVRKMTEWGYELIKHDYTTYDLFGSFGCTLNGKITAKDGWSFRDETKTSAEIVLELYRS
IREAAGNAVIIACNAVSHLSAGIFEVYRTGDDTSGRVWSRTRAYGVNTLAFRLCQNDAFY
KVDADCVGIIPGKLDWSLNRQWLDLLSVSGSPLFVSVQPDAAVGEIKADLIKAFSRSATQ
HDLAEPLDWLYNNQPQVWLVNGETREYDFVEASYPELLSGNTQSY

Enzyme Prediction     

No EC number prediction in MGYG000003296_01777.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.72e-38	173	427	1	247	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	8.48e-10	142	324	258	468	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	1.57e-07	179	318	46	191	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
pfam02638	GHL10	0.002	194	362	19	199	Glycosyl hydrolase-like 10. This is family of bacterial glycosyl-hydrolase-like proteins falling into the family GHL10 as described above,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY91961.1	1.30e-154	49	509	17	471
QGQ95278.1	1.10e-153	32	520	46	529
ANE49069.1	6.48e-151	47	522	10	486
CBL19648.1	1.32e-147	7	517	37	547
QTH40116.1	9.84e-147	24	509	37	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LCJ_A	1.88e-15	169	503	154	444	TtGalA,alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_B TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_C TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_D TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_E TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCJ_F TtGalA, alpha-galactosidase from Thermus thermopilus in apo form [Thermus thermophilus HB8],6LCK_A TtGalA, alpha-galactosidase from Thermus thermophilus in complex with p-nitrophenyl alpha-D-galactopyranoside (alpha-NPG) [Thermus thermophilus HB8],6LCK_B TtGalA, alpha-galactosidase from Thermus thermophilus in complex with p-nitrophenyl alpha-D-galactopyranoside (alpha-NPG) [Thermus thermophilus HB8],6LCK_C TtGalA, alpha-galactosidase from Thermus thermophilus in complex with p-nitrophenyl alpha-D-galactopyranoside (alpha-NPG) [Thermus thermophilus HB8],6LCL_A TtGalA, alpha-galactosidase from Thermus thermophilus in complex with stachyose [Thermus thermophilus HB8],6LCL_C TtGalA, alpha-galactosidase from Thermus thermophilus in complex with stachyose [Thermus thermophilus HB8],6LCL_E TtGalA, alpha-galactosidase from Thermus thermophilus in complex with stachyose [Thermus thermophilus HB8]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003296_01777.