CAZyme Information: MGYG000003300_00783

Basic Information

• Species: Porphyromonas gingivalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas gingivalis
• CAZyme ID: MGYG000003300_00783
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		27020.19	9.6056

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003300	1801215	MAG	Mongolia	Asia

• Gene Location: Start: 1039; End: 1749 Strand: -

Full Sequence      

MIRIDVVLPAYRPGQGWEREAISRLTALSDSIPDVTFRIFIVPDGSNEGHSDEVRSHWAT
SPWEVIYCDYAKNRGKGFAVRYGVGQTDAPFVLYTDYDLPFTLDSYKQVIEALLEGADVV
ISRREPESYGKKIRFKRKMLSDFSHFVNKFFFLPTTDTQGGLKGFSSAGRFIFLQTRIDS
FLFDTEFICLAKRKKVCIEVVSGSIRPDISLSVMKAKTILREVYKIPKLIKARWFS

Enzyme Prediction     

No EC number prediction in MGYG000003300_00783.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04188	DPG_synthase	1.23e-28	6	202	1	201	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
cd04179	DPM_DPG-synthase_like	9.01e-23	6	191	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
PTZ00260	PTZ00260	3.78e-15	6	221	74	311	dolichyl-phosphate beta-glucosyltransferase; Provisional
COG0463	WcaA	5.15e-06	1	233	2	224	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	2.27e-04	6	121	1	110	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATS06534.1	2.50e-171	1	236	1	236
AKV64852.1	1.02e-170	1	236	1	236
AUR46611.1	1.02e-170	1	236	1	236
ATS09886.1	1.02e-170	1	236	1	236
AAQ66784.1	1.02e-170	1	236	1	236

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2EK20	2.13e-09	7	196	78	278	Dolichyl-phosphate beta-glucosyltransferase ALG5B OS=Trichomonas vaginalis OX=5722 GN=ALG5B PE=1 SV=1
A0KGY7	9.04e-06	4	136	9	141	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003300_00783.