CAZyme Information: MGYG000003306_00196

Basic Information

• Species: CAG-448 sp003150135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-448; CAG-448 sp003150135
• CAZyme ID: MGYG000003306_00196
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000003306_11|CGC3	91286.09	4.9531

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003306	2266147	MAG	China	Asia

• Gene Location: Start: 34199; End: 36625 Strand: -

Full Sequence      

MKINLTNPWSLTVLPHRLWRSLTAGCSDLTCAADLPTPVAPATVEGAVTVPATVPGNFEL
DLFRAGLIPDPFFGTNIIDLRKLEDRHLFYVTTFDAPPDGTDGLVLHFEGIDTVAKVYVN
GEQAAACDNMFIPWDVPLRNLRPTGNEIMVHILPAMMVAQERPVPPAAGAFDHSYASLTL
RKSPASFGWDILCRAVSGGIWRPVWLETVKAAPALDQVYLYTFAVDPSAEDRNRGGAMLD
LYYAFRTADELTVGYEVAVEGQCGTSHFAARREVWHACGNYHIPVPDARLWYPKNAGEQN
LYDVRVTLLRNGVVEDAREFRIGIRLAELDRTSCIDADGKGEFRFLINHKPVFLMGSNWV
PLDAFHSRDAERLPEALRLLDEAGCNAVRCWGGNVYEDTPFFDFCDEHGILVWQDFAMGC
ALYPVWDEGLRENLRREALSVVRKLRHHPSLCLWAGDNECDLFWMMCYPFRRNPAENTLT
RELLRDVLWAEDFTRPYLPSSPYVDEVAFARGAQGTSEDHLWGPRDYFKGDFYRTAPCHF
ASETGYHGCPDPASLREYIPEDQLWPIYDEGTAEDPFRGTPNPAWLAHQTSMELNETNTF
GYRIGLMTSQVRHMFRDVPDSIDTYARMSQMSQAEAFKYFIERFRTAKWSKTGIIWWNLL
DGWQQVSDAVVNYNFRPKLAYSFIRRAQEPVLMAFSDPQQDGRYDLHAVNDTQTAVVLTY
EVRDLCGAASQDAAPLLLSGTVTVPADGNTVAARLDLTGRLDHVLHIRWTDADGNTHTSH
YIAEPKHLEYRPYADALHLCGFDCFAGF

Enzyme Prediction     

No EC number prediction in MGYG000003306_00196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	50	725	6.3e-74	0.6236702127659575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.79e-59	45	793	25	733	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.83e-13	89	461	68	419	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	1.12e-09	218	325	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	1.90e-08	702	787	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	4.67e-08	222	461	228	451	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46202.1	1.63e-171	48	790	22	741
QGA23305.1	4.47e-168	41	795	54	797
AZN42912.1	4.33e-165	34	783	35	753
QNL40264.1	1.48e-149	52	713	61	715
QUT78882.1	4.14e-149	52	713	61	715

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.23e-80	52	712	46	675	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.61e-68	50	792	26	761	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.66e-68	50	792	28	763	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.68e-68	50	792	28	763	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.21e-68	50	792	26	761	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	2.27e-73	55	691	32	660	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q95327	5.63e-61	45	697	35	698	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q4WAH4	4.63e-60	42	766	20	739	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	8.58e-60	42	766	20	739	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q2TXB7	9.97e-59	45	763	24	735	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999990	0.000047	0.000008	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003306_00196.