CAZyme Information: MGYG000003306_01531

Basic Information

• Species: CAG-448 sp003150135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-448; CAG-448 sp003150135
• CAZyme ID: MGYG000003306_01531
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000003306_67|CGC2	37339.43	5.0877

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003306	2266147	MAG	China	Asia

• Gene Location: Start: 149536; End: 150564 Strand: +

Full Sequence      

MQNQVIDRRVEEILSGMTVEDKVGQLFIVRRPQDDGVAMDALRRYRLGGFTLYACDFENR
TPESVRALLASYREAATVAPFIAADEEGGRVVRASKYPQFRDLPFPAPRDLFAAGGYAAV
ETDTREKAAFLLDLGVNFNYAPVCDMSGNPDTFIYNRTFGNDPTATARYVDTVVRTMNAC
GLVGSIKHFPGYGDNVDTHTGIAHDDRSRETFLTRDLAPFRAGIAAGAPIVMVAHNIVSC
MDPDCPASLSPAVHSLLREELGFEGLIITDSLDMGAITQYTHDRASAVQAVLAGNDLLCC
STYERQVPAVLDAIADGTIPLARIEQSVRRVLALKLRMGIAR

Enzyme Prediction     

No EC number prediction in MGYG000003306_01531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	77	299	4.4e-45	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.09e-61	17	340	1	317	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	6.82e-60	18	334	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	9.50e-39	36	342	10	313	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.81e-21	7	340	35	358	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ63470.1	5.26e-118	7	340	82	413
BCI61427.1	7.19e-118	7	340	150	481
QNM02560.1	9.94e-118	6	340	85	417
QWT55932.1	6.16e-114	8	340	106	436
ABX42693.1	5.62e-113	8	340	77	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	6.59e-41	15	340	9	342	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	3.52e-36	12	340	37	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.44e-35	12	340	11	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.74e-35	12	340	41	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3TEV_A	4.69e-34	24	316	19	308	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.92e-35	12	340	37	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.62e-33	40	338	57	383	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B4SRK3	1.37e-32	40	299	17	272	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
B2FPW9	5.13e-32	40	299	17	272	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
Q8PB42	3.44e-30	40	324	17	300	Beta-hexosaminidase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003306_01531.