CAZyme Information: MGYG000003308_00265

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-10
• CAZyme ID: MGYG000003308_00265
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		42487.75	5.3613

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003308	2610589	MAG	China	Asia

• Gene Location: Start: 3857; End: 4984 Strand: -

Full Sequence      

MNKGAMTPATIYADAGRPEWKAAGRQWQGIPAIERTGRGRLFACWYSGGKTEEPGNIIVV
EKSDDDGRTWSDGFCTVAHDDGEVRCFDPALWIDPKGRLWLFWTQSWMYYDNRDGVWAAL
CDDPDAENVVFGAPRRLMNGLMLNKPIVTKKGAWLFPAALWSRAFSRPWEDHPELRDEEK
ANVYASLDAGETFERRGGVDMPERAFDEHCLVELSDGRLWMTVRTKYGIGQAFSADGGRT
WENIGPSGHTGPNSRFFVRRLKSGRLIMVNHVNPTCQTSPLDWNARNNLMAMLSDDDGRT
WRGALVLDTRNEISYPDGVQADNGDIYIIYDRERCGAREILMAVFTEEDVLEGRLVSPRG
RLRQLVNRATGEREK

Enzyme Prediction     

No EC number prediction in MGYG000003308_00265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	29	333	9.5e-34	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	4.94e-48	30	346	16	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	4.12e-28	39	328	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	2.36e-04	95	334	95	363	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd08978	GH_F	4.50e-04	8	111	41	138	Glycosyl hydrolase families 43 and 62 form CAZY clan GH-F. This glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) includes family 43 (GH43) and 62 (GH62). GH43 includes enzymes with beta-xylosidase (EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanases (beta-xylanases) and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. GH62 includes enzymes characterized as arabinofuranosidases (alpha-L-arabinofuranosidases; EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose side chains from xylans. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. GH62 are also predicted to be inverting enzymes. A common structural feature of both, GH43 and GH62 enzymes, is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN08048.1	5.10e-122	4	369	5	376
AWL41261.1	7.00e-122	4	369	5	375
QEG17440.1	2.64e-121	5	371	33	390
QGQ32653.1	3.77e-121	28	371	3	338
QDU15387.1	1.51e-120	5	371	33	390

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003308_00265.