CAZyme Information: MGYG000003308_00450

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-10
• CAZyme ID: MGYG000003308_00450
• CAZy Family: PL15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700	MGYG000003308_162|CGC1	79471.09	5.7349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003308	2610589	MAG	China	Asia

• Gene Location: Start: 325; End: 2427 Strand: +

Full Sequence      

MMKTLLQQPVRSGQIFPSPRENETMYETPPCFCWREEEGARSYRVEVKGAAGEIVWSGET
EKTFIVPERAIEPGEYRWNLYAAGGERGWVRFFIADNAVRFARPDAKTLLSAVPDERPRH
LFFQSDVKEIVRTHPEAISTLQRNVALALEDGLPEPPRYHVDETALPYRDYFGRHRDYCD
RDLVACALAHVLLDDARAAAHAKSLFLALCDWNSEGPCSLEGPWGDEVGLSHARCFPAVF
DLLWDILDEKQRVFAARVVSLYAYQCERKLNGIDFCQNPGNSHAGRLPAYLGEAALVLKG
TDAVPQETLERWLNLALDVYGGIFPYFGGPDGGWAEGMFYASSYTKWYLPFFSAVERFSG
VSYLKRPFYQRLIRYFQHFCPPGWEIHPFGDGYWCRSDDAEWPGFFAQNPYHIYAERFGD
ALTRSWSRQAQNQEIFKLHLLDVFLPDGQSERDALSGPSTRAGFFPDAGYVSLHTDPKHP
ESELALLARSSRYGSISHEHADQGSFALMAGGTAMISPSGYFGRQYGTKHHFEWTNQTRA
HNTILVDGAGQEPFSFRATGCVLYAREEDGRLTAAIDPSHAYEHIAAWTRSFELTENALI
VTDHIELDAPGEIAYLLHTLSRPEAAGESAAVERNGWRMTIAPEKGDLHDLTISDRFDVD
LNEGEPEAYRVTMPPQYHLRWVTPKRRVHDIRVRYDVRRG

Enzyme Prediction     

No EC number prediction in MGYG000003308_00450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL15	479	597	1.4e-27	0.9029850746268657

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	3.39e-14	458	700	2	228	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam16332	DUF4962	2.98e-09	17	424	11	434	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44278.1	8.89e-174	15	681	12	678
AJR05048.1	3.28e-118	14	691	11	699
ANO33566.1	1.42e-117	14	655	11	672
AYO23963.1	1.66e-116	14	691	11	689
AOM00979.1	5.90e-114	14	619	11	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A0O_A	1.09e-35	3	629	11	671	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	1.93e-34	3	629	11	671	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]
6LJA_A	7.34e-11	17	623	41	707	ChainA, Heparinase II/III-like protein [Bacteroides intestinalis DSM 17393]
6LJL_A	1.14e-09	17	623	41	707	ChainA, Heparinase II/III-like protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003308_00450.