CAZyme Information: MGYG000003308_01946

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-10
• CAZyme ID: MGYG000003308_01946
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		73592.61	5.5526

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003308	2610589	MAG	China	Asia

• Gene Location: Start: 15; End: 1970 Strand: +

Full Sequence      

MQLEMAANGMTGRLDDFWPSVKESAWRGGAGDSWERAPYYLDGLVPLAWILDDARLKGKA
MRYIDWTLQSQREDGFFGPADNEDWWPRMVMLKALIQYYTATSDARVPEFMFRYFKYQYR
MLDEKPLRDWAVPRGAENIEAVVWLYNITGSKFLLSLMKRLRAQTLDWTRHFHAFPYTRS
MSEILPWEALKAGLEKENAPLSGQDRPYYATQYHLSHVVNTAMGLRAGAIMSQFTDSERD
REAFAVGYDRLMRHHGVASGMFNGDEHLSGNAPTQGTELCAVAEMMYSCELLPTTGADWT
GAGDILEKLAFNALPAAVSADLMAHQYDQQVNQISCTVDKRPWYNNADDSNIFGLEPNYG
CCTANMHQAWPKYAASLWYATRDQGFYCMSFAPCTVTFFSGDVPVRIDVDTRYPFERSVK
IRVSPAHPSEFPIRVRIPAWTKGVVGALVNGEEYEGGRSDGHLEIRRVWQSGDCVTLILP
MGARVTRWSRRSAAVEYGPLLMAMPIKAEEKCIREDADAPDYEARPRSSWKFALVEGAAF
DYMPLERDGCFGAGCGPVVLAQAVELPQWGKKGVNCAPTPVEPALEESYTHTLPLIPYGD
TVLRIAQFPYATLKKDLGADPKRFMDSLRDARHEVALIKQEITLNDEMNRS

Enzyme Prediction     

No EC number prediction in MGYG000003308_01946.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	231	503	3e-29	0.5248508946322068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.93e-48	39	503	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.84e-21	53	503	84	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMP98056.1	1.25e-120	2	631	57	668
QNK64903.1	6.47e-120	2	631	51	662
ALL07583.1	7.29e-119	2	609	57	649
ATP55412.1	1.05e-118	2	631	57	668
AOM80627.1	2.00e-116	2	618	51	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.38e-11	44	504	83	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.63e-10	44	480	83	531	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003308_01946.