CAZyme Information: MGYG000003310_00043

Basic Information

• Species: UBA10281 sp900764105
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900764105
• CAZyme ID: MGYG000003310_00043
• CAZy Family: GT2
• CAZyme Description: UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276	MGYG000003310_2|CGC2	31647.62	9.7986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003310	1965862	MAG	China	Asia

• Gene Location: Start: 10407; End: 11237 Strand: -

Full Sequence      

MELMPFSVAISVYAKDNPAYFDRALESITEKQTIIPDEIVLVVDGPIPEESNSVIKKYAS
RYSIFNIIRLEKNGGLGNALKIAVDNAKFELIARMDSDDIAASDRFEQQLNFLSKNPKVD
IVGGDISEFIDDEENIVAYRKVPTTDGEIKNYLKKRCPFNHVAVMYKKTSVMNAGGYMDL
FWNEDYYLWIRMVENGAVTANTGTILVNVRTGKDMYKRRGGRKYFKSEKFLQKYMLKHKI
IGFGTYISNVAKRFIVQILLPNNIRGWVFKKFARRG

Enzyme Prediction     

No EC number prediction in MGYG000003310_00043.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	167	1.5e-21	0.9117647058823529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	8.75e-83	7	210	1	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	1.80e-19	12	131	3	120	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.42e-17	7	140	1	130	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.22e-14	7	212	1	196	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	1.50e-10	2	267	1	261	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALU14403.1	1.69e-109	1	274	13	289
QYX28872.1	1.19e-97	68	274	1	207
AOP03537.1	3.63e-97	1	274	1	272
ADV44095.1	2.26e-90	7	274	5	272
AGU77111.1	2.23e-89	6	274	4	272

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48215	1.29e-57	4	275	1	267	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
Q03084	1.63e-57	6	275	8	273	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase OS=Escherichia coli OX=562 GN=wbbD PE=1 SV=1
Q46635	1.97e-50	6	271	2	262	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2
Q4KXC9	6.58e-16	7	255	10	253	O-antigen biosynthesis glycosyltransferase WbnJ OS=Escherichia coli OX=562 GN=wbnJ PE=1 SV=1
Q58457	9.67e-15	7	195	11	197	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003310_00043.