CAZyme Information: MGYG000003312_00364

Basic Information

• Species: Bacteroides sp900547205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900547205
• CAZyme ID: MGYG000003312_00364
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000003312_10|CGC4	37472.2	9.1612

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003312	4657579	MAG	Estonia	Europe

• Gene Location: Start: 197708; End: 198688 Strand: +

Full Sequence      

MKKITQINYILTFILVFCIGATIPVLIGSSQVSDQHSVKSEVPYCVTPPTVPTQAIFDGE
TIDLRRYDRRERMDREMMAFTYMHSTTMLLIKRANRYFPIIEPILKANGIPDDFKYLMVI
ESNLNNIARSPAGAAGLWQFMPATGREFGLEVNENVDERYNIEKATVAACKYFKQAYAKY
GDWMAVSAAYNAGQARISSQLEKQLASHAMDLWLVEETSRYMFRLLAAKEIFSNPERYGF
LLKREHLYPQIPYKKVTVNTPIDNLSDFAKKQGITYAQLRDANPWLRETSLKNKSGKTYV
LLIPTQEGMYYDPKKTVPYNSNWVID

Enzyme Prediction     

No EC number prediction in MGYG000003312_00364.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	97	234	1.3e-22	0.9185185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	6.75e-62	105	230	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	2.12e-25	81	302	92	310	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	1.28e-22	100	204	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	9.71e-18	117	228	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.13e-15	97	233	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94901.1	1.73e-223	1	326	1	326
QUT70157.1	3.21e-219	1	326	1	326
BCA49012.1	4.16e-219	1	326	8	333
QUR42145.1	6.47e-219	1	326	1	326
ALJ43129.1	9.19e-219	1	326	1	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.85e-24	70	302	78	307	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.85e-24	70	302	78	307	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.663201	0.327781	0.004239	0.000900	0.000493	0.003394

TMHMM  Annotations     

start	end
7	29