CAZyme Information: MGYG000003312_01575

Basic Information

• Species: Bacteroides sp900547205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900547205
• CAZyme ID: MGYG000003312_01575
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	MGYG000003312_43|CGC1	47999.13	4.3396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003312	4657579	MAG	Estonia	Europe

• Gene Location: Start: 30832; End: 32154 Strand: +

Full Sequence      

MKKISYILISGCITLSLVGCDDAFDTSNTSAGILSLSESGLNILQSYNVGEKYNADLWIQ
HGGLELNNGSVTFTVDKSLLDSLNTADGTSYQMLPEDCYQMTQATVNVSADERIAKGTIT
YDPTKIHALCGYDKVQYILPLKASSTGEQLNPERSTILLGFNVSEPIVTIMGADVQEINV
NNIKELPITVGVPFTNKWDITCSLVSNQSLVDTYNSANQTYFSLLSAESYTVPESPVLTP
GVSQATVSYKLKDNMLPGNYMLPVQIGEVTSDATIRADKDAYSAFCIIKEGDKIAKTNWE
VLSFTTQETSGEGAGNGLAKCLIDGDTETFWHAKWQGGSTPLPYDIVIDMKQNIQIAQVE
LLPRGRGTNNPLKVVEFYASEDNVNWTPIGRFGFTNQDAALEYYVKSIKARYIKLTIPDD
GGNTTVAAIRELDVKGTIIN

Enzyme Prediction     

No EC number prediction in MGYG000003312_01575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	306	432	8.8e-19	0.9354838709677419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	1.60e-18	309	432	4	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam08522	DUF1735	1.36e-14	28	146	2	116	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam08522	DUF1735	2.27e-12	161	272	7	119	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT38597.1	6.19e-286	1	440	1	440
QQA06495.1	5.08e-285	1	440	1	440
AAO75972.1	5.08e-285	1	440	1	440
QMW87891.1	5.08e-285	1	440	1	440
BCA50208.1	7.22e-285	1	440	1	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GGL_A	9.32e-104	280	440	1	161	X-RayStructure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. [Bacteroides thetaiotaomicron],6OE2_A X-Ray Structure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. Re-refinement of 3GGL with correct metal Mn replacing Zn. New metal confirmed with PIXE analysis of original sample. [Bacteroides thetaiotaomicron]
2KD7_A	8.39e-97	291	440	2	151	ChainA, Putative chitobiase [Bacteroides thetaiotaomicron VPI-5482]
3F2Z_A	1.65e-74	291	440	2	151	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]
4A41_A	9.22e-08	317	434	45	159	CpGH89CBM32-5,from Clostridium perfringens, in complex with galactose [Clostridium perfringens],4A44_A CpGH89CBM32-5, from Clostridium perfringens, in complex with the Tn Antigen [Clostridium perfringens],4A45_A CpGH89CBM32-5, from Clostridium perfringens, in complex with GalNAc- beta-1,3-galactose [Clostridium perfringens],4AAX_A CpGH89CBM32-5, from Clostridium perfringens, in complex with N- acetylgalactosamine [Clostridium perfringens]
2V72_A	6.62e-06	305	434	17	141	Thestructure of the family 32 CBM from C. perfringens NanJ in complex with galactose [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000067	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003312_01575.