CAZyme Information: MGYG000003312_02450

Basic Information

• Species: Bacteroides sp900547205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900547205
• CAZyme ID: MGYG000003312_02450
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	MGYG000003312_68|CGC1	53751.93	6.4408

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003312	4657579	MAG	Estonia	Europe

• Gene Location: Start: 29924; End: 31390 Strand: +

Full Sequence      

MNKKLLATLSAFIIISSTMANATTPDYPAPDRSKIIAFPGADGAGKYTTGGAGGTVYTVT
SLADDNSEGTLRWAIGKKGPRTIVFAISGIIELQQPLRLNNGDVTIAGQTAPGDGICLKN
YTFSIQADNVIVRFIRSRMGVDIKQKGDDAMNGTKAHKDIIIDHCSMSWCTDECATFYDN
SNFTLQWCLISESLANSIHEKGAHGYGGIWGGQPATFHHNLLAHHTNRTPRLCGSRYTGR
PEDEKVELFNNVIYNYGSDGAYAGEGGSYNFINNYYKPGPFSATKGSFKRLFTAYADDGK
NNNEAGVHGVFYLKGNYMDPTCSKLTDKQKEALYKVNMDNSYGFIIKKDFAPEKEVLSRK
AFDIAEHTSLQTAKKAYKDVLQFAGASFRRDAVDQRIVEETRKGIYTYEGSHGSTNGMID
QPTDVGGWTEYKSETAPIDSDGDGIPDEWEKKHNLNPNDPSDGAQYTLSREYTNLEVYMN
SLVNHLFP

Enzyme Prediction     

No EC number prediction in MGYG000003312_02450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	88	276	1.2e-77	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	1.43e-09	4	286	5	287	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	3.27e-06	90	268	3	175	Amb_all domain.
pfam18884	TSP3_bac	2.23e-04	439	460	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94498.1	0.0	1	488	1	489
QGT73501.1	0.0	1	488	1	496
QRQ55765.1	0.0	1	488	1	496
SCV08373.1	0.0	1	488	1	496
ALJ48955.1	0.0	1	488	1	496

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	1.02e-48	33	483	18	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	2.00e-47	33	483	18	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
B0XMA2	3.96e-47	35	483	21	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q5B297	5.63e-47	35	483	20	411	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
Q4WL88	7.66e-47	35	483	21	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999061	0.000184	0.000175	0.000167	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003312_02450.