CAZyme Information: MGYG000003312_02639

Basic Information

• Species: Bacteroides sp900547205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900547205
• CAZyme ID: MGYG000003312_02639
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864	MGYG000003312_73|CGC1	99261.08	5.5715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003312	4657579	MAG	Estonia	Europe

• Gene Location: Start: 71976; End: 74570 Strand: +

Full Sequence      

MMINFTGKMVQVACGLLCCCSMAYTQTNDTSDILVLNTGWEFTQSGTGKWMTGVVPGTVH
QDLIRHELLPNPFYGTNEQKIQWVENEDWEYRTSFILSEDQLKRDDAQLIFEGLDTYADV
YLNGSLLLKADNMFVGYTIPVKSVLRQGENLLHIYFRSPIKQTLPQYESNGFNYPADNDH
HEKHLSVFTRKAPYSYGWDWGIRMVTSGVWRPVTLRFYDVATIGDYHVNQLELTDDKARL
SNELQVNSILPKQAEAELKITVSLAGQKVSEVKEPILLQPGINNFTLPVEVINPVRWMPN
GWGEPTLYDFSSQIVCNNQVVAEQTHRIGLRTIRLVNEKDKDGESFYFEVNGIPMFAKGA
NYIPQDALLPNVTAQRYETLFKDIKEANMNVVRIWGGGTYEDNLFYDLADENGILVWQDF
MFACTPYPSDPTFLKRVAEEAEYNIRRLRNHPSLAMWCGNNEILEALKYWGYQKKFTPAV
YQGMMDGYDKLFRELLPAKVKELDADRFYVHSSPYLANWGRPESWGIGDSHNWGVWYGQK
PFESLDADLPRFMSEFGFQSFPEMKTIATFAAPEDYQIESEVMNGHQKSSIGNALIRTYM
ERDFIVPDKFEDFVYVGLVLQGQGMRHGLEAHRRNRPYCMGTLYWQLNDSWPVVSWSSID
YYGNWKALHYQAKRAFEPILINPLQQNDSLSVYLLSDKLEDMEQMTLEMKVISFDGKKLG
KPMQLKSLIIPANTSRCIYQSKLDACVPAGERQHSFMKLILKDKSGRNVAETVHFFAKTK
DLLLPDTNISYKMKQTDGKCELTLSAGSLAKDVFIEIPLQGARFSDNFFDLLPGERKTIT
ITSPQIKKGEELPMTLKHIRETYN

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	23	803	4.1e-110	0.7819148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.90e-109	30	853	9	794	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	7.58e-20	786	857	1	72	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	2.77e-17	688	781	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	5.14e-12	85	462	107	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	1.30e-11	221	331	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT38054.1	0.0	1	863	1	863
AAO75565.1	0.0	1	863	1	863
QMW87505.1	0.0	1	863	1	863
ALJ42441.1	0.0	1	863	1	863
QUT70759.1	0.0	1	863	1	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WBK_A	0.0	26	863	1	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	0.0	26	863	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]
2VJX_A	0.0	26	863	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	0.0	26	863	3	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	0.0	26	863	3	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	5.01e-130	36	859	9	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	1.98e-129	36	859	9	842	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	8.12e-128	36	859	9	842	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q4WAH4	2.29e-127	36	850	9	835	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	6.30e-127	36	850	9	835	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007201	0.482722	0.508173	0.000943	0.000509	0.000423

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003312_02639.