CAZyme Information: MGYG000003312_03593

Basic Information

• Species: Bacteroides sp900547205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900547205
• CAZyme ID: MGYG000003312_03593
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	MGYG000003312_100|CGC2	59978.55	5.7577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003312	4657579	MAG	Estonia	Europe

• Gene Location: Start: 26356; End: 27945 Strand: -

Full Sequence      

MNKVIGKKRIAILSFLYICVAGGCSRPAATVSYQIETDKPCQTMTYFSASDAWSMQFIGL
WPQEKQNQIADWLFSTENDANGQPKGIGLSLWRFNVGAGSAEQGDASQIASPWMRAECFL
NADGTYDWNKQQGQRNFLKLAKERGVDKFLAFLNSPPVFYTQNGLATNTGRGGTANLKPD
CYEKYAGFLADVVQGVEKHDGIKFNYICPFNEPDGHWNWVGPKQEGCPATNKEVARTVRL
LSKAFVDRKMDTQILVNESSDYRCMFRTHETDWQRGYQIQAFFCPDSVDTYLGDTPNVPR
LMLGHSYWTTTPLSELRNYRCQLRDTLDKYNVDFWQTETCIMGNDEEIGGGNGYDRTMKT
ALYVARIIHHDIVYAGARSWQWWRAIGGDYKDGLIREYTDDDYKDGRVEDSKLMWALGNY
SRFIRPGAVRLSVSAFDKAGVIMPEGDTDQQGLMCTAYRNVDGTYVMVVINYAEQEKDFS
ITGDKLEDLQWQVYRTSDTEGENLLPVGKVKSHEKTLIPARSVITLLSK

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	33	526	3.4e-198	0.9917355371900827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.03e-148	30	395	1	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	3.00e-16	1	527	1	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	9.32e-06	427	526	1	63	Glycosyl hydrolase family 30 beta sandwich domain.
COG0366	AmyA	0.006	346	494	354	505	Glycosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39884.1	0.0	1	528	1	529
QIU93355.1	0.0	6	529	3	528
QGT72499.1	0.0	6	528	3	527
QUT79243.1	0.0	6	528	3	527
QDM10652.1	0.0	6	528	3	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.19e-89	42	527	17	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	8.79e-12	66	527	59	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	4.53e-10	29	471	1	386	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.49e-09	29	471	8	393	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
1NOF_A	4.67e-09	148	529	77	383	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	8.05e-16	26	274	17	268	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	4.87e-10	29	471	25	410	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000203	0.999841	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003312_03593.