CAZyme Information: MGYG000003312_03643

Basic Information

• Species: Bacteroides sp900547205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900547205
• CAZyme ID: MGYG000003312_03643
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677	MGYG000003312_100|CGC4	75532.43	6.0484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003312	4657579	MAG	Estonia	Europe

• Gene Location: Start: 96968; End: 99001 Strand: -

Full Sequence      

MRILNLLILSLISYLTLQAATPEKELWQLRTSDIHAEYVGAPVANGGIGLLPWKEPFSIQ
HVILNHVFDTDGPQGVSRVLKGINPLLLTMEVDGKKIDAGNISNWEQTIDMKEATHNSRF
TADGKAEVSYSICALRNMPYAGLIRVEVKALAPCFLKVTNHMDVPDEYVSPQSRFRTLYD
GGARMDVFQTSALSKHRKVEVAASSAFLFDKDANHQSVTPVYNEGSRQSSITIALKQGET
YSFALAGAICSKRDFVDPYNESERQVIYAIHEGTDRLMNAHRRLWDELWQSDVCIEGDDE
AQRTVRFALFNLYSFARAGSALSISPMGLSSQGYNGHIFWDTELWMYPPMLLLNQGIAES
MINYRTNRLAAACKRAGSYGYRGAMFPWESDDAGEESTPTFALTGPFEHHITADIAIACW
EYYCITRDKHWLQSQGYPMMKAAAEFWVSRAERNDDGSYSIRNVVGANEYASGVDDNAFT
NGAAIRALEYACKAAKACGFSAPNEWKEVGQNIRILSFPDGVTRENATYNGEMIKQSDAN
LLAYPLGVITDPKRWKKDMEYYADRIDPNNGPAMSYSVFCVQYARIGDEEKAYEMFLRCF
EPNLRAPFGVIAETATSNNPYFATGAGGLLQAVINGFCGLQVTEKGVVQVSSVLPKHWKK
VTVTGVGTEKKTFERRQ

Enzyme Prediction     

No EC number prediction in MGYG000003312_03643.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	306	644	1e-99	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	1.09e-102	84	661	83	718	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	2.18e-62	306	644	1	384	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	8.02e-38	78	669	80	728	maltose phosphorylase; Provisional
pfam17389	Bac_rhamnosid6H	0.005	415	598	103	291	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT91743.1	0.0	26	675	26	672
QIU93251.1	1.17e-315	1	677	1	669
QUT79346.1	4.46e-308	1	677	1	668
QDM10252.1	4.46e-308	1	677	1	668
QNL39805.1	1.81e-307	1	677	1	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.22e-204	38	673	36	674	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	3.06e-51	233	658	232	711	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	1.14e-33	73	662	75	710	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTP_A	1.48e-29	84	658	78	706	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.97e-29	84	658	78	706	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	2.86e-74	232	644	210	629	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
Q8L163	5.91e-60	263	662	282	733	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
A0JMP0	3.56e-55	230	666	141	585	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1
F1NZI4	7.02e-55	254	666	209	637	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q8RBL8	2.70e-53	260	662	276	730	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999195	0.000146	0.000146	0.000129	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003312_03643.