CAZyme Information: MGYG000003312_03680

Basic Information

• Species: Bacteroides sp900547205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900547205
• CAZyme ID: MGYG000003312_03680
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	MGYG000003312_100|CGC6	58333.72	6.4005

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003312	4657579	MAG	Estonia	Europe

• Gene Location: Start: 165750; End: 167309 Strand: +

Full Sequence      

MNDNMKVLKSLLLGVCVATFLSACTHQEVATQTNEYGTQWKWDKGTIIVETPERPSGQQS
VVGLALPKMEVVRVGFVGLGMRGPGAVERFTHIPGVQIVALCDYEQERAEKCQQYLKNAD
MPKAAVYYGEKGYEELCKRDDIDLVYIATDWLHHFPVAMCAMENGKNAAIEVPSAMNLKE
CWSLIEMSEKTRKHCMILENCCYDWFEMNTLNMAQQGVFGEVIRAQGAYIHDLSPFWKHY
WKKGEEDKLGWRLEYNMKHRGDVYATHGLGPVAQALDIHRGDRMKTLVAMDTKSVMGKEW
QKAAADTACNDFRNGDHTTTLIRTENGKVIEIQHNVMTPQPYNRLYQLTGTKGFANKYPT
QGYAVGGEQLAASGVQPQVDNLSAHGFLPKAEMDALVEKYRHPILKKYGEMAKEVGGHGG
MDFIMDSRLVYCLQNGLPLDMDVYDLAEWCCLAELGTLSMDNNCASVAIPDFTRGEWNKI
KGYKHAYASPEEEAASMEKAKAFTAKLKEQGAKEWGNRI

Enzyme Prediction     

No EC number prediction in MGYG000003312_03680.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	68	479	1.3e-161	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.09e-22	69	401	1	306	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	8.47e-12	72	197	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	3.82e-04	70	222	3	145	putative oxidoreductase; Provisional
COG4091	COG4091	7.03e-04	72	166	18	127	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT44459.1	0.0	5	515	1	509
QRQ49631.1	0.0	5	515	1	509
QUU07042.1	0.0	5	515	1	509
QQT78254.1	0.0	5	515	1	509
QRP56502.1	0.0	5	515	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	3.97e-87	54	477	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	5.07e-66	72	481	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	3.90e-07	64	251	1	177	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3E9M_A	1.09e-06	108	226	39	152	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	0.0	5	515	1	511	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	0.0	5	515	1	510	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	4.31e-243	8	512	3	502	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	8.91e-206	8	488	1	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	2.93e-205	6	488	3	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000058	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003312_03680.