CAZyme Information: MGYG000003313_00321

Basic Information

• Species: QAMM01 sp900552945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; QAMM01; QAMM01 sp900552945
• CAZyme ID: MGYG000003313_00321
• CAZy Family: GH120
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653		73306.83	5.4401

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003313	2159275	MAG	Estonia	Europe

• Gene Location: Start: 19847; End: 21808 Strand: +

Full Sequence      

MNREIHVAKTGSDLAAGTREEPFLTISQAAKVAETGDTVIVHEGEYREWVKPQHSGYSNI
SRITYQAAEGEKVVIKGSERIQNWEPVEGTVWKAVIPNAFFGDYNPYAERLDGDWYAWPA
DKFVHPGEIYLNGKSFYEARTLDEVKHPQKRVDFTPPWSTRVEKILEPEQTIYQWCCEVD
AQNTTLYANFQGADPNRELVEINVRKCCFYPDKVGMNYITVRGFEMAQAACPWTPPTADQ
PGLLGANWSRGWIIENNIIHDAKCSGISLGKEASTGHNLSIRRRQKPGYQYQMEAVFRAL
QIGWSKEKIGSHIVRNNVIYDCGQNGVVGHMGCVFSEIYGNEIYNINVKHEFFGYEIAGI
KLHAAIDVQIHNNSIHSCALGTWLDWQAQGTRVSCNLYYHNDRDLMIEVTHGPCLVDNNL
FASSHSLDDYAQGTAYVNNLFCGKTHAEKVLDRSTPYHFPHTTQVAGTAVVYGQDHRYYN
NIFTAYDGYETTAPAGRGINGCGTAVYNGSTASYEEYHQKIVDQGIGDLELFQRTEQPVY
AGCNAYFNGAEAFDREQENCCMPEFSPHVKVSHEADGVYLELDIPEEMLSLLSRVHSTET
LGTVRIVDAIYDAPDGSFITLDTDLLGRKRSEHPCAGPLEGLTAGHNRVKVWG

Enzyme Prediction     

EC	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH120	311	401	4.8e-38	0.989010989010989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	6.67e-04	310	401	32	137	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam07602	DUF1565	0.002	10	48	2	40	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEY66102.1	0.0	1	653	1	644
QHQ61564.1	0.0	1	653	1	644
QNU68147.1	0.0	1	653	1	644
ACL75901.1	0.0	1	653	1	644
QBE96849.1	0.0	1	653	1	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VST_A	1.46e-291	4	652	2	638	Thecomplex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_B The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_C The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_D The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_A The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_B The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_C The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_D The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_A The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_B The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_C The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_D The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94576	4.53e-08	5	85	36	114	Uncharacterized protein YwoF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywoF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003313_00321.