CAZyme Information: MGYG000003314_00748

Basic Information

• Species: Actinobaculum massiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinobaculum; Actinobaculum massiliense
• CAZyme ID: MGYG000003314_00748
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633	MGYG000003314_11|CGC1	68359.77	4.6239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003314	1984209	MAG	Finland	Europe

• Gene Location: Start: 49441; End: 51342 Strand: +

Full Sequence      

MPTSAHDLPLQPLLHDGVCTFKAPFQAWSRHDGNMTRPADGVFVGDTRIISARELRVADR
HPEHLDSAIVGGSQAVFSGAVRYLDTSGADPRVVVRTRRSVSESGFRERITIHNGLAEAL
ETELCVNLHVSLDTMSAIKAGNSPTDDPGITLAGGASCEVSGAGITAKITAEGAEAEHSG
GEVSFVWKVKVPAHSSLTSEWEIVLVDSELPVGPAGITANLSFRPQVADARAIRWLEQAE
PDLENLLMTVRAEPELPFFAAGAPWFFTLFGRDSLWAARLVLPATWRVAATTLAVLAKFQ
GTRNNPDTAEQPGKIMHELRFEDFNIPGEGVRLPPLYYGTIDATPLWISTLFDAHKAGMP
LSDVEALLPNLRRALDWIVNDADSDGDTFLEYIDESGHGLANQGWKDSGDSIQWNSGDLA
EGPIALCEVQAYAYEALLKGASLLEKFDGDGEAYRARAEEIKANFHAQFWVEDEVGPYPA
IALDKSKRPVDSLTSNIGHLLGTGILTHEEEGIVAERLIGEDMNSGFGLRTLSTTAGGYW
PLSYHGGSVWTHDTAIAIVGLMRAGFEHHAKTLIDSLLRAAEAFEYRLPELFSGDGSLSH
PLPYPASCRPQAWAAASAIAVADCLARIEAAEN

Enzyme Prediction     

No EC number prediction in MGYG000003314_00748.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	1.30e-62	196	611	202	592	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam06202	GDE_C	2.80e-13	337	611	79	365	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam14742	GDE_N_bis	2.16e-07	26	202	7	193	N-terminal domain of (some) glycogen debranching enzymes. This domain is found on the N-terminal of some glycogen debranching enzymes and is usually followed by the GDE_C (PF06202) and in this sense it is analogous (but probably not homologous) to the GDE_N (PF12439). Its exact function is unknown
pfam17389	Bac_rhamnosid6H	6.77e-05	369	508	125	274	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYF72297.1	1.44e-211	9	621	5	652
SEN32805.1	9.07e-211	9	621	51	673
SDI72482.1	9.07e-211	9	621	51	673
SFL73515.1	9.07e-211	9	621	51	673
SDH67146.1	9.07e-211	9	621	51	673

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003314_00748.