CAZyme Information: MGYG000003317_00668

Basic Information

• Species: Lentilactobacillus buchneri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus buchneri
• CAZyme ID: MGYG000003317_00668
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206	MGYG000003317_56|CGC1	23408.16	11.2435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003317	2478253	MAG	Russia	Europe

• Gene Location: Start: 8280; End: 8900 Strand: -

Full Sequence      

MRKQSWRVIVILLVTFAVLIAGVSLRGQLSHHAQRNSVPTLVQKRPDHFSTRQKRSFINR
VGTPAVKLYLKNRQVLPSVVIAQAILESQFGTSELTTTANNLFGIKGTYHGQSVQFYTRE
VENGKSIKVLAQFRKYPNLAASIADHNQLVSEKFIKAKNILSYRKSTRLLQANGYATDPH
YAAKLNRLIVKYQLSRYDLKAINERV

Enzyme Prediction     

No EC number prediction in MGYG000003317_00668.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	65	194	6.8e-32	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	8.50e-49	7	198	4	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	3.56e-34	51	204	317	478	amidase domain-containing protein.
smart00047	LYZ2	6.16e-33	55	198	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK06347	PRK06347	2.87e-29	55	198	151	303	1,4-beta-N-acetylmuramoylhydrolase.
NF038016	sporang_Gsm	4.86e-24	57	198	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUX04950.1	4.52e-141	1	206	1	206
AEB72768.1	9.11e-141	1	206	1	206
AFR99634.1	1.29e-140	1	206	1	206
QGV24265.1	2.42e-120	1	206	1	206
APR06679.1	6.68e-109	1	206	1	207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	5.61e-24	56	198	32	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	8.85e-23	55	198	61	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN4_A	5.61e-15	55	206	4	155	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	4.25e-14	55	189	4	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	6.20e-12	80	189	26	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.03e-31	37	198	33	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	5.00e-22	50	198	58	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
Q2G222	8.14e-22	55	198	321	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P0C2T5	9.32e-22	50	198	58	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	4.55e-21	77	198	84	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.837260	0.155290	0.003045	0.000914	0.000642	0.002876

TMHMM  Annotations     

start	end
5	27