CAZyme Information: MGYG000003317_02048

Basic Information

• Species: Lentilactobacillus buchneri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus buchneri
• CAZyme ID: MGYG000003317_02048
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258		28026.75	9.7184

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003317	2478253	MAG	Russia	Europe

• Gene Location: Start: 2041; End: 2817 Strand: -

Full Sequence      

MKALIATVAVTGFCFVQANHSHASVETDFINQLKTPVVKISKANHLYPSVMMAQAIVESD
FGRSELSLDANNYFGVKGAYNGQSVTMSTGEYTSKGKHYMTAAAFKKYPSVEASIKDNAY
LLRHGTLSDPNYYEGTWTTNAISSSDAAMALSLTYATDMNYGNKLNAIITKYDLNKLDGS
VSTGDIGSKIDASLNKQLAGDSKKSALIRAENSRSKINSIPKRIIPNFVFNDKGAVAINQ
GDAVIQFNSLPLQRVVRR

Enzyme Prediction     

No EC number prediction in MGYG000003317_02048.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	37	174	8.2e-28	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	8.86e-45	3	190	16	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	1.00e-41	18	207	143	332	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	3.23e-39	27	178	321	472	amidase domain-containing protein.
smart00047	LYZ2	6.12e-29	28	179	10	145	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	3.21e-21	38	117	5	76	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS00453.1	6.09e-181	1	258	2	259
QUX05738.1	3.52e-180	1	258	2	259
AEB73548.1	1.38e-179	1	258	1	258
QGV25979.1	1.30e-152	2	258	3	258
APR08225.1	1.11e-151	1	258	2	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.02e-39	21	178	25	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	5.30e-29	29	178	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RHZ5	4.55e-31	29	185	65	221	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P37710	5.12e-31	27	187	181	342	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	1.56e-30	29	190	65	225	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P0C2T5	1.68e-30	29	185	65	221	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	3.30e-30	29	188	65	224	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999028	0.000201	0.000168	0.000168	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003317_02048.