CAZyme Information: MGYG000003317_02168

Basic Information

• Species: Lentilactobacillus buchneri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus buchneri
• CAZyme ID: MGYG000003317_02168
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207		21496.26	10.0175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003317	2478253	MAG	Russia	Europe

• Gene Location: Start: 14016; End: 14639 Strand: +

Full Sequence      

MVITIKKSLLTLSVVAGFLGFTGVAASASTYTVKSGDTLAEIAAKHNSSVDTLVKQNKIA
DKNLIMVGQKLEIGKSAKKTTAKKVNKKHFKTSTSIKKGSAHAAVVTSQSGSDNSTNGAT
SSATTTPAAFQSQGVIYQDGKKWTYYTGAAFADGTTNHGGYDADGYLIVAAPSDVPFGTH
VQTPLGEGVVHDRGTAIVGNHYDLVMP

Enzyme Prediction     

No EC number prediction in MGYG000003317_02168.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.18e-13	30	73	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.45e-12	30	73	1	44	Lysin motif.
pfam01476	LysM	3.49e-10	31	73	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd14667	3D_containing_proteins	1.56e-08	144	207	4	72	Non-mltA associated 3D domain containing proteins, named for 3 conserved aspartate residues. This family contains the 3D domain, named for its 3 conserved aspartates, including similar uncharacterized proteins. These proteins contain the critical active site aspartate of mltA-like lytic transglycosylases where the 3D domain forms a larger domain with the N-terminal region. This domain is also found in conjunction with numerous other domains such as the Escherichia coli MltA, a membrane-bound lytic transglycosylase comprised of 2 domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, corresponding to the 3D domain and Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial LTs, which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond.
COG0739	NlpD	6.73e-06	29	162	2	135	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUX04892.1	3.68e-136	1	207	1	207
AEB72703.1	3.68e-136	1	207	1	207
AFR99573.1	5.23e-136	1	207	1	207
QOP50653.1	1.35e-108	1	207	1	206
QOJ85509.1	1.35e-108	1	207	1	206

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.999106	0.000155	0.000173	0.000155	0.000140

TMHMM  Annotations     

start	end
9	31