CAZyme Information: MGYG000003318_01736

Basic Information

• Species: Duodenibacillus massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Duodenibacillus; Duodenibacillus massiliensis
• CAZyme ID: MGYG000003318_01736
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000003318_90|CGC1	41312.62	9.2981

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003318	2001584	MAG	Estonia	Europe

• Gene Location: Start: 5058; End: 6167 Strand: +

Full Sequence      

MRLTPFVTAAAAALMFAASAHASWDLWDKMKAVGMEDARVVDYSDSRSITTSEGQSYALF
FALVAGDRDTFEKMVKWTQDNLAGGRLDKTLPAWLWGATGGDGAARRWGIIDTNNAVDSD
MWIAYCLLEAGRLWNRPDYTDKGKQMMALIAKEIRDVKNVGKVLLPGRMGFETKDTVKLN
PSYYPLFILRRFAEIDPMWNAVFDGSLRVLLRSAPKGFAPDWVRFDKEGRIVEMQDPDNA
IGSYNAIRTYLWAGMMSPKDPAYAVLKRQFQPMVEAAVTLGAPPEKVNLNTLAMNKAGNP
GFAACILELAERTPSAQKAAARIRTMLTAMPVQKDNYYTNMLIFFGLGFDYRLFAFDENG
RVWFPRAAK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	24	349	1.2e-77	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	1.96e-140	23	363	24	365	cellulase.
COG3405	BcsZ	1.28e-69	23	365	25	353	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	2.32e-51	27	350	8	319	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53874.1	6.18e-142	1	362	1	358
QQS88762.1	2.11e-140	17	366	22	363
ANU67169.1	1.32e-123	23	366	21	352
QQQ96024.1	1.32e-123	23	366	21	352
QDA53782.1	7.37e-98	3	366	46	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2B_A	2.76e-91	23	362	3	339	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
5CD2_A	2.32e-84	4	362	10	363	Thecrystal structure of endo-1,4-D-glucanase from Vibrio fischeri ES114 [Aliivibrio fischeri ES114]
3QXQ_A	5.58e-81	23	362	3	335	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F81_A	1.57e-79	23	362	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	4.42e-79	23	362	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZLB7	1.64e-83	18	362	20	357	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8X5L9	1.27e-82	16	362	17	356	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
Q8Z289	3.68e-82	18	362	20	357	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P37651	2.01e-81	16	362	17	356	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	1.77e-74	12	362	21	371	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000435	0.998839	0.000180	0.000183	0.000171	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003318_01736.