CAZyme Information: MGYG000003319_01432

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E
• CAZyme ID: MGYG000003319_01432
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		43985.65	6.1795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003319	1809679	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 276; End: 1397 Strand: +

Full Sequence      

MNTYTTDFDALMRDLNSRPVNPDKLVSRNAGESAKRLFDYLKSIYGRHILAGQQYLQQEE
LEDVVYFNATGKLPAVRGYDLMDMDKKKGDDQVNRAIKWAKDTGCIITLCWHWYAPDDMD
NTENCTWSFYYKTTSYDHKTSFDLLRAVTPGTKEYDFAVTRIDKAAAVLRRFEQEDIPVL
FRPLHEANGSWFWWGRREDSPEESVAAYKKLWYMIFDRFENFHKLSNIIWVWNGQDKDMA
VHPNTFDICGEDIYSEIPNDHSSQKPRFDNVTSYTNGKMAALSECGFIPDPDELKREGVK
WLWWLPWWGSFVYAVEGWKPVFNKKNQPYCNQKYLNEVFLMKAFQNPYCITLDRLPFYKG
NSGLPEKFRNEQK

Enzyme Prediction     

No EC number prediction in MGYG000003319_01432.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	26	353	6.2e-85	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.60e-48	26	309	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	3.37e-08	152	260	157	262	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL34792.1	5.62e-157	4	366	3	350
CBK96404.1	1.60e-156	4	366	3	350
CBK96003.1	7.72e-98	4	370	70	442
CBL34396.1	2.18e-97	4	370	70	442
QOT08285.1	5.85e-79	20	360	11	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.89e-50	26	325	7	296	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	4.07e-48	20	372	141	462	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	9.20e-47	24	359	44	360	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	1.32e-35	25	324	4	325	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
3WDQ_A	2.65e-35	14	356	29	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	6.51e-49	22	316	143	438	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	1.34e-46	29	316	178	454	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	4.13e-44	17	312	26	324	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55296	5.70e-43	13	362	147	467	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55298	2.56e-42	20	362	152	466	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003319_01432.