CAZyme Information: MGYG000003323_00407

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000003323_00407
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000003323_166|CGC1	56137.93	5.6281

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003323	2041599	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 2968; End: 4422 Strand: +

Full Sequence      

MFKTMPENFLWGGALAGCQAEGAYLEDGKTLTIPECMKFGKVDHKVTRQLKITMDAIHEA
ENDLDLVKYPKRRGIDFYHTYKEDIKLLAGMGFKCFRYSFSWARVFPYGDAEQPNEKALA
FYDDLIDTIRSYGMEPLMTISHFDFPVYLVEKYGGWYNRKLIEMYEKYCKVLFERYKGKV
KYWVTFNEINMSIKAGPKTMGVVDQGQPNYEEMLFQALHHQFVAAAKVTKMAHEIDLENK
IGCMVAYFATYPYTCKPEDSLAAQYDDNMRNLYFLDSLNGMALPYYAQAYFAKKGIHINV
EDGDLELIKQYQADFVGMSYYNSMVSAADDSQLELTSGNVSNAYKNPHLPANAWGWQIDP
VGLRYTLNHVYDRYHKPVFILENSSGFVDKLEEDGTVHDPYRVEFLREHIKTMMQAVEED
GVDVIGYTMWGPIDMISSSTSEMTKRYGFIYVDQDDYGNGTMKRYIKDSYYWYRDVIKSN
GKKL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	481	1.7e-136	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	4	484	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	3	482	2	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	3	484	4	477	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	4.96e-179	4	484	3	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	9.67e-165	4	484	5	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR97375.1	2.52e-268	1	484	1	484
AGF58682.1	7.20e-268	1	484	1	484
QLG37377.1	7.86e-263	4	484	5	485
APO43426.1	6.12e-260	3	484	4	485
QZN77335.1	8.68e-260	3	484	4	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.01e-166	3	484	6	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.52e-153	4	484	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	1.19e-149	6	484	21	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	4.35e-148	3	481	5	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.24e-147	3	481	5	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.53e-168	3	484	6	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	5.39e-155	3	484	2	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46829	8.34e-153	4	484	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.18e-152	4	484	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P26206	1.11e-149	1	484	1	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003323_00407.