CAZyme Information: MGYG000003323_01578

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000003323_01578
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		34077.36	5.431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003323	2041599	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 942; End: 1883 Strand: -

Full Sequence      

MILHVARDGSGDFTTITEAVNAVPYEIEAEIEIAPGIYREKLVCEKRQITLRGAGAEKTK
LVWGDGGKLPHPDGRPIHTFRSYTAFFSGERLTVEDLTIENDAGPGSAVGQAVAAYVDSA
QAVFRNVTLLGNQDTLFCAPLPEKEREKDGFLGPRCFAPRRPSAQYYQGCTIAGDIDFIF
GGGDALFEQCILRTVNNHIPHSYVTAPSGHAERLGFVFWDCDFVSDCPAGTVYLSRPWRP
EGKTAVLDCRLGAHIAPEGFSPWNDRTDTNLACFAEAGSTGAGAAERPDWVEKPSAAEAA
DLLKRARKRCRPV

Enzyme Prediction     

No EC number prediction in MGYG000003323_01578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	303	8.7e-77	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	9.41e-56	1	298	83	392	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	3.70e-46	5	290	4	274	Pectinesterase.
PLN02773	PLN02773	6.24e-45	2	303	6	291	pectinesterase
PLN02682	PLN02682	6.46e-40	3	299	71	352	pectinesterase family protein
PLN02432	PLN02432	5.24e-39	1	306	11	284	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA44050.1	7.41e-191	3	312	4	313
ATP00222.1	7.41e-191	3	312	4	313
AXA81880.1	2.16e-186	1	312	2	313
CBK98674.1	6.19e-186	1	312	2	313
AXB27671.1	2.75e-181	1	311	2	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	2.35e-23	5	290	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	2.42e-23	5	285	11	274	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.68e-17	5	285	35	336	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	7.66e-16	13	289	18	316	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	2.00e-12	13	289	18	316	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	4.30e-36	2	290	6	278	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	2.87e-32	5	290	260	531	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8VYZ3	2.32e-31	7	303	90	370	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9FJ21	4.47e-30	5	290	262	533	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q9LXD9	1.02e-29	5	290	243	523	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003323_01578.