CAZyme Information: MGYG000003326_01869

Basic Information

• Species: Blautia sp900541955
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900541955
• CAZyme ID: MGYG000003326_01869
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000003326_40|CGC1	34960.02	8.6582

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003326	2715873	MAG	United States	North America

• Gene Location: Start: 76827; End: 77741 Strand: +

Full Sequence      

MTVTVIVPTYKPDGKFFQLMNMLKRQTCKADHILIMNTEERYWKNSFMEGLDNWEVHHLS
RAAFDHGKTRGEGAKLADTEILVYFTQDAVPADEKLLENLLKPFHNPQVGAAYARQLPAE
DCKIIERYTRSFNYPDTSRIKTKKDIPELGIKTYFCSNVCAAYRRGVYEEMGGFVTRTIF
NEDMIMAAQMIQAGYGVAYAAEARVVHSHNYGYMQQLRRNFDLAVSQEDHPEIFAAISSE
SEGIRLVKSTAAYLIKQGKPWLISDLLLSSGFKYLGYKAGRNYKHLPPSWVHRLTMNPAY
WENR

Enzyme Prediction     

No EC number prediction in MGYG000003326_01869.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	2.09e-11	2	206	55	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	1.02e-08	2	219	3	226	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04186	GT_2_like_c	3.56e-06	147	209	103	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06434	GT2_HAS	2.08e-04	2	116	1	114	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
COG1216	GT2	2.49e-04	73	207	76	219	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99516.1	4.41e-183	1	302	1	302
QJU13078.1	3.87e-143	2	301	5	304
ANU76706.1	6.38e-142	2	301	5	304
QQQ94283.1	6.38e-142	2	301	5	304
ASU29511.1	6.38e-142	2	301	5	304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	9.90e-68	1	303	1	304	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003326_01869.