CAZyme Information: MGYG000003329_00355

Basic Information

• Species: Veillonella sp900550455
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp900550455
• CAZyme ID: MGYG000003329_00355
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		30369.65	5.1946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003329	1615634	MAG	United States	North America

• Gene Location: Start: 60428; End: 61261 Strand: +

Full Sequence      

MTVKQQTIKKPIEYTGIGLHSGQPVTMTLKPAPVNTGIVFIRTDIDGHPSVKADIKNVTN
TMRATTLEDGEAKVFTVEHVMAAFSGMGVDNCYVEMNSPEPPVGDGASTVFVGLIEGAGL
VEQEADRRVHVIKKMHAVYDGDRFVIALPYEDYRITFTSVNSHPLLGTQQSDVVITAESF
KKEIASARTIGFVKELEQLQAMGLAKGGSLENALVYDDDKCLSIPRFDDELVRHKSLDVM
GDLYLLGPIKGHIIAQKSSHELNSRLSRSIVQEIEED

Enzyme Prediction     

No EC number prediction in MGYG000003329_00355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	5	271	5.3e-100	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	5.54e-151	5	272	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	9.96e-138	4	270	3	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	1.81e-119	4	270	3	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13188	PRK13188	3.14e-110	1	276	1	304	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
TIGR00325	lpxC	6.31e-93	3	270	1	271	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG93959.1	5.06e-153	1	276	1	276
CAB1276550.1	3.40e-151	1	276	1	276
BBU36768.1	6.85e-151	1	276	1	276
QQB16515.1	1.96e-150	1	276	1	276
BBU34837.1	1.96e-150	1	276	1	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MO4_A	1.46e-79	2	271	5	279	Co-Crystalstructure of P. aeruginosa LpxC-50067 complex [Pseudomonas aeruginosa PAO1]
6MO5_A	1.51e-79	2	271	6	280	Co-Crystalstructure of P. aeruginosa LpxC-50228 complex [Pseudomonas aeruginosa PAO1],6MOD_A Co-Crystal structure of P. aeruginosa LpxC-50432 complex [Pseudomonas aeruginosa]
6MOO_A	2.21e-79	2	271	7	281	Co-Crystalstructure of P. aeruginosa LpxC-achn975 complex [Pseudomonas aeruginosa]
5U39_A	4.59e-79	2	271	3	277	Pseudomonasaeruginosa LpxC in complex with CHIR-090 [Pseudomonas aeruginosa PAO1]
4J3D_A	6.91e-79	3	271	2	275	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6VB79	1.61e-78	3	271	2	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=lpxC PE=3 SV=1
B7UZI4	4.56e-78	3	271	2	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=lpxC PE=3 SV=1
P47205	4.56e-78	3	271	2	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lpxC PE=1 SV=2
B5ELD7	6.66e-78	3	271	2	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31) OX=380394 GN=lpxC PE=3 SV=1
B7J3W7	6.66e-78	3	271	2	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) OX=243159 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003329_00355.