CAZyme Information: MGYG000003332_00956

Basic Information

• Species: Prevotella sp900550035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900550035
• CAZyme ID: MGYG000003332_00956
• CAZy Family: GH154
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	MGYG000003332_94|CGC1	24788.26	7.4087

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003332	2583592	MAG	China	Asia

• Gene Location: Start: 2252; End: 2908 Strand: +

Full Sequence      

MSIGEEYDGYVLTVGLNKMSEWYLSDGWYSDGPEFAMDYYNSYVMHPMMVEVVEICKKRN
FHTPVSLDLAVKRMNRFNEILERFISPEGAYPAVGRSVIYRMGAFQTLAMSAWKYGLPKT
LSNGSVRSALTAVMKRMFAVDGNFNDKGYLQLGFAGHQPGLANYYSNNGSLYMTSLVFMP
LGLPANHPFWTAPAEQWTSQKAWSGQQFPEDYHTSLRK

Enzyme Prediction     

No EC number prediction in MGYG000003332_00956.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	2	195	2.3e-61	0.5402298850574713

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10022	DUF2264	8.01e-89	2	197	160	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
COG4289	COG4289	6.72e-43	2	208	180	379	Uncharacterized protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO26474.1	3.26e-123	1	217	180	396
QQT78394.1	1.25e-118	1	218	194	411
ASM67775.1	1.25e-118	1	218	194	411
QRP56361.1	1.25e-118	1	218	194	411
QUU06875.1	1.25e-118	1	218	194	411

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003332_00956.