CAZyme Information: MGYG000003334_00026

Basic Information

• Species: Lactobacillus gallinarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus gallinarum
• CAZyme ID: MGYG000003334_00026
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	MGYG000003334_1|CGC1	26954.88	9.9264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003334	1842627	MAG	China	Asia

• Gene Location: Start: 24403; End: 25107 Strand: +

Full Sequence      

MKRYHHKYTLPAILTLLILAIAFLLIGFFNFKKQTTLPPDSNSSPIGIELNQDIDYVDLH
KLQSNGISFVYLKATQGRSYFDENYLSYRDQILGTQLAFGSEISYSNESTALQHYHYFFN
QVGNNTGSLPILIIPVAGLSKKYLKSMSKFTQMLQQRGKTVMVELDQKYRHYFDSATLFM
STDKKAPNKLKYSFWRYTTNGRVKDVSGLEKGITMYAYNGTVSQYKQKYGQLTQ

Enzyme Prediction     

No EC number prediction in MGYG000003334_00026.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	56	204	3.7e-21	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06419	GH25_muramidase_2	3.06e-56	38	204	1	177	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	3.75e-11	47	208	2	179	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06413	GH25_muramidase_1	1.55e-09	57	220	15	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	4.83e-06	61	208	20	185	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
COG3757	Acm	8.59e-06	28	208	44	246	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR22496.1	3.24e-157	1	234	1	234
AZK91170.1	3.24e-157	1	234	1	234
QPB52133.1	3.24e-157	1	234	1	234
ALJ23409.1	3.24e-157	1	234	1	234
QAU30798.1	3.24e-157	1	234	1	234

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000002	0.000028	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
7	29