CAZyme Information: MGYG000003335_00793

Basic Information

• Species: GCA-900066135 sp900543575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066135; GCA-900066135 sp900543575
• CAZyme ID: MGYG000003335_00793
• CAZy Family: PL27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000003335_87|CGC1	38484.37	4.5049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003335	3295822	MAG	China	Asia

• Gene Location: Start: 8388; End: 9398 Strand: -

Full Sequence      

MHGGSVKIVGEKLLQLPVEKLQRRVDALPETEGQSADEDGDQQRAEKDLPEGMIVIPDID
LVRKDEGDFPALGHFLGEDPVTLEIVQSINPTLTIPEGDSATDNYYTRYIKDNMNIDISV
KWFASSSDYKEGGRKFYPIKLPITLLMEELKKAGWQKEYDELLKLFVEHADHLCEVGKNY
PASEVNYEQSIVAPAADVILSVYLLTGDKKYLDEGARQVEILELFNGMQPDYHLNEVAIR
HWDGYWFGKRRYYGDTFPHYWSGLTGKVFEMYGEILKDENWIKRGEASIRGVLPLFFTDG
RASCAYVYPLEVNDRRAAFFDPYANDQDWGLYANIR

Enzyme Prediction     

EC	4.2.2.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL27	110	332	9.7e-96	0.36065573770491804

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13580	PBP2_AlgQ_like_1	0.002	79	131	1	48	Periplasmic-binding component of alginate-specific ABC uptake system-like; contains the type 2 periplasmic binding fold. This subgroup includes uncharacterized periplasmic-binding proteins that are closely related to high molecular weight (HMW) alginate bining proteins (AlgQ1 and AlgQ2) found in gram-negative soil bacteria. The HMW alginate uptake system is composed of a novel pit formed on the cell surface and a pit-dependent ATP-binding cassette (ABC) transporter in the inner membrane. The transportation of HMW alginate from the pit to the ABC transporter is mediated by periplasmic HMW alginate-binding proteins (AlgQ1 and AlgQ2). Alginate is an anionic polysaccharide that is made up of alpha-L-mannuronate and its 5'-epimer, alpha-L-guluronate. Alginate is present in the cell walls of brown seaweeds, where it forms a viscous gum by binding water. Alginate is also produced by two bacteria genera Pseudomonas and Azotobacter. AlgQ1 and AlgQ2 belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. However, unlike other bacterial periplasmic-binding proteins that deliver small solutes to ABC transporters, AlgQ1/2 can bind a macromolecule and may have specificity for either sugar or a certain type of polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDP95951.1	5.75e-81	129	336	421	628
QTE69095.1	4.34e-77	122	332	377	592
ADL35858.1	5.46e-77	115	332	364	582
ALJ58888.1	6.65e-75	57	331	382	684
EEF91483.1	1.82e-74	57	331	382	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NO8_A	6.67e-76	57	331	382	684	PolysaccharideLyase BACCELL_00875 [Bacteroides cellulosilyticus DSM 14838],5NO8_B Polysaccharide Lyase BACCELL_00875 [Bacteroides cellulosilyticus DSM 14838]
5NOK_A	1.31e-75	57	331	382	684	PolysaccharideLyase BACCELL_00875 [Bacteroides cellulosilyticus DSM 14838],5NOK_B Polysaccharide Lyase BACCELL_00875 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003335_00793.