CAZyme Information: MGYG000003335_01708

Basic Information

• Species: GCA-900066135 sp900543575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066135; GCA-900066135 sp900543575
• CAZyme ID: MGYG000003335_01708
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000003335_187|CGC1	39520.78	4.5599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003335	3295822	MAG	China	Asia

• Gene Location: Start: 5137; End: 6156 Strand: -

Full Sequence      

MNIYESACEKAQEGLWNCFFDEKTGVMVNHMPVREEENWIYWWHAHALDALLDGYLRKPE
GEYLERFRKEYAGTYRENGNTLLHNWYDDMEWMTLALLRAWDATKDEEYKKQALFVWEDI
KTAWNDYCGGGMAWKKDQLDYKNTPANAPAAIIAFRLYQRFGKKEDLEWGEKIFTWNRDQ
LMDPETCFVWDGMNREGDGKIDKEWKFTYCQGVMLGAALEYYRITGEKEQLELAKKIARR
AVVELAGEDGIFNYEGKDDCGLFRGIYFRYLYELVMAADDCDDLKKIILKNADAVSKAMR
EDGLVGGDWRSVSAGEIDLAQHLSGVMVLEMAAKLVKED

Enzyme Prediction     

No EC number prediction in MGYG000003335_01708.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	5	314	1.4e-82	0.8910614525139665

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	1.60e-58	21	335	21	352	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.50e-27	41	309	34	330	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
cd04791	LanC_SerThrkinase	0.006	212	274	90	158	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97536.1	1.94e-124	4	335	5	340
AGA56980.1	9.90e-117	9	310	19	323
AYQ74079.1	9.50e-113	19	338	4	327
ANY75148.1	2.80e-111	3	339	16	358
QTH44606.1	5.77e-110	1	335	1	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	3.97e-74	11	338	10	343	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	2.85e-72	37	335	84	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	9.13e-71	37	335	85	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	7.18e-70	37	335	85	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4MU9_A	1.34e-27	51	309	86	338	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003335_01708.