CAZyme Information: MGYG000003335_01767

Basic Information

• Species: GCA-900066135 sp900543575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066135; GCA-900066135 sp900543575
• CAZyme ID: MGYG000003335_01767
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710	MGYG000003335_192|CGC1	79020.46	5.9941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003335	3295822	MAG	China	Asia

• Gene Location: Start: 5344; End: 7476 Strand: +

Full Sequence      

MESKIERLLKELTLDEKIGMIHGKGLFETKGVERLGIPPLKLSDGPMGVRNEFPGDSWVP
VGNSDDYVSYLPSNSALASTWNRKLAGKCGQVLGEEARGRGKDVILAPGINIKRSSLCGR
NFEYMSEDPYLAGEMAVPLIEGIQKADVAACVKHFALNNQETDRLWVEVEVSDQALREIY
LPAFKKAVKKAGALSLMGAYNRYKGEHCCESKELLTDILRKEWGYDGMVVSDWGAVHDTK
KAAESALDLEMSVTYDFDNYCLARPLKEAVEKGEISEGLIDEKVKNILQLMDRLHMLPGE
HRQSGSYNTPEHQKTLLKAAEESIVLLKNENHILPLKPERIRKLLVVGDNANRAHSGGGG
SAEIKAFYEITPLLGIKMLLGGNTRVDFCQGYLADDFLTKEAGWQEESLKDGGGKTAGEK
DTDGALLQKQKELREEALRKAALYDQVIFVGGLNHQQDLEGRDRPDMKLPYAQDQLILEL
LKAKPDTVVVMAAGSPVEMGAWLSRAKALVWNWYAGMEGGKALAEVLFGKVNPSGRLPES
FPFSHMDCPAHCIGEFPGGKTVAYREGIFVGYRYYETRQVPVAFPFGYGLSYTEFTYERL
KARVKGNGNGAKVQVTLGVVNTGAMKGKEVVQLYVGRKNSGEDRPIRELKAFDKISLKPG
EIKNLEFMLDMEAFSYYDEKEKEFRVEKGAYIISVCRSSHEVWMETEVEL

Enzyme Prediction     

No EC number prediction in MGYG000003335_01767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	30	251	2.3e-68	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.54e-93	5	689	38	751	beta-glucosidase BglX.
PLN03080	PLN03080	8.29e-78	8	705	56	778	Probable beta-xylosidase; Provisional
COG1472	BglX	1.99e-75	34	385	57	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	7.03e-63	324	592	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.05e-45	2	290	16	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU68450.1	5.51e-300	2	710	3	709
BBF45282.1	7.20e-293	1	710	6	714
QEH68829.1	4.21e-289	5	708	9	724
ADZ83364.1	5.97e-289	5	708	9	724
QNO17540.1	8.72e-289	4	708	12	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.46e-159	1	710	1	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	4.21e-130	5	702	6	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
5WAB_A	3.03e-129	9	702	9	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3ABZ_A	7.92e-126	5	702	6	828	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.04e-124	4	702	3	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	9.32e-180	1	702	42	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	7.98e-159	1	710	1	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
Q5BB53	1.73e-139	5	695	6	816	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
Q4WU49	3.91e-133	5	702	6	822	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
A1DFA8	3.91e-133	5	710	6	829	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003335_01767.