CAZyme Information: MGYG000003337_00041

Basic Information

• Species: Ruminococcus_C sp900765125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp900765125
• CAZyme ID: MGYG000003337_00041
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		89983.75	4.6506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003337	2462692	MAG	China	Asia

• Gene Location: Start: 121; End: 2586 Strand: +

Full Sequence      

MNIRAGAHYTQFYVADFDLDGKAEMTCKTADGTIDGQGKVIGDKSKDYRNSSGFIITGPE
YYTLFDGATGKALDTINYEPGRGDTTKWGKSSDKTNRVDRFWGAVAYLDGVHPSVVTGRG
YYGRMTATAYKVENKKLVKLWAFDTGTSSSAAGYGDGNHNSMAADVDGDGKQEIINGSTC
IDDNGKLLWSTNQGHGDAMHLGDLLPDRNGLELWICHEDKPYGVSLVDASNGKIIFHKDG
SGDTGRCCADNVWSGNNGAEFWGLNNDVFDGSGNTLSCRRPAINFLSYWDGDLEREILDG
YTDSPATISKMKADGTLTTLLSTNGYYTCNTTKGTPCLSADIFGDWREELIVRAANSKSV
RIYCTPYTTDYRITTLMHDIQYRTQVAGQNTAYNQPPHLSYYLGTEKGVPKRETVQVMKP
GQIIPIEPVNPLTEATLVEGAVYTIQNVNSGLYMEVEGAKDANGTNVQQWGMDTPSGHNT
WRVLSAGDGYYYLYPQIGDKASYALDVTAKKPDDGTNMEIYNSNFNDAQKFKFMKNADGN
YFILTKVSGDKSCVAVSSASKSSGANVIEWTMNTSDASQMWVLNQVDQVGCKMDTSKEYT
FKNVNSGLYMEVANASAQDNANIQQWGIGDAPASHNTWTLKQFQTDSDLYYIYSRLADGK
TYVINSTGSGDGANIELLTYNNKTSSMLFKFVKNPDGSYYIQPRTGRDSKVVEVADASQS
SGANIGQWSINGNACQKWNLEAYEVTTTTTTTDTTTTTDIPVEIIGDVNLDGRMDIIDVL
IIQKYLVNISNEIKGNADLNNDGRINIFDLIIAKNIVIDSL

Enzyme Prediction     

No EC number prediction in MGYG000003337_00041.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	2	415	3.6e-170	0.7049742710120068
CBM13	442	587	5.5e-19	0.6968085106382979
CBM13	596	756	5.1e-17	0.7712765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	2	401	168	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam14200	RicinB_lectin_2	4.63e-14	436	521	8	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	4.09e-11	577	677	1	88	Ricin-type beta-trefoil lectin domain-like.
cd14256	Dockerin_I	7.32e-11	765	817	1	56	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	2.24e-10	766	815	1	53	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16296.1	4.50e-278	2	790	199	948
ADU23014.1	5.89e-187	2	681	203	891
QEH66923.1	1.82e-164	2	586	201	780
ADZ85364.1	5.37e-164	2	646	201	849
ADU21778.1	4.73e-158	2	417	201	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CAG_A	1.03e-122	2	415	178	587	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	1.60e-121	2	417	175	603	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
2Z8R_A	1.85e-117	2	404	171	569	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31527	6.96e-121	2	417	175	603	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1
O31526	2.33e-116	2	404	208	606	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003337_00041.