CAZyme Information: MGYG000003338_00493

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas
• CAZyme ID: MGYG000003338_00493
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		36475.38	7.3707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003338	3210940	MAG	United States	North America

• Gene Location: Start: 2554; End: 3510 Strand: +

Full Sequence      

MKKYIFACLLFFSLCAFSQEKTEYIVDRNGTGDFRTIQEAIKAVRTGDPRGQITIRVKNG
IYKEKLVLPPHVTHVHIIGEDRDKTIINYDDHANINKMGTFKTYTFLLSGNDVILENLTI
ENSSEELGQGVALHIEGDRIILRNCRLLGHQDTLYAGRDGARQYFEDCYIEGTTDFIFGP
STAWFEGCTIHCKKNSYITAANTPQNIKYGYIFNNCHITVADGITSVYLGRPWRAYAMTL
FMNCNLPKEIKPEGWDNWRNPDNERTARYMEYNNKGEGASVNHRVKWAKILTKEQAAEYT
KEQVLRGCDNWNPITILN

Enzyme Prediction     

No EC number prediction in MGYG000003338_00493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	24	306	1.2e-105	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	8.76e-79	26	299	9	290	pectinesterase
pfam01095	Pectinesterase	1.23e-74	25	307	3	297	Pectinesterase.
PLN02432	PLN02432	9.61e-68	26	311	15	291	putative pectinesterase
PLN02682	PLN02682	1.34e-63	25	296	72	352	pectinesterase family protein
COG4677	PemB	1.86e-63	33	307	93	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53311.1	7.60e-170	1	316	1	316
QIK58728.1	8.84e-169	1	316	1	316
QRX62574.1	9.22e-130	23	305	482	764
QQY38333.1	3.39e-128	16	314	17	315
ALK82867.1	3.39e-128	16	314	17	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	5.36e-41	25	298	10	294	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	7.17e-41	25	307	6	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	4.13e-36	34	313	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	9.53e-34	32	284	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.86e-33	32	284	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.66e-56	26	299	9	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	2.00e-54	21	315	255	560	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9FM79	8.05e-51	25	311	83	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8GX86	4.45e-50	16	313	248	555	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
Q9FJ21	6.23e-50	21	313	257	560	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000846	0.686696	0.311625	0.000286	0.000288	0.000247

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003338_00493.