CAZyme Information: MGYG000003338_00834

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas
• CAZyme ID: MGYG000003338_00834
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		47660.01	7.4404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003338	3210940	MAG	United States	North America

• Gene Location: Start: 27; End: 1265 Strand: +

Full Sequence      

MFFYNLAISLYAFVVRLISPFHKKARKMVAGHKQVYKTLEEKVDENAEYIWFHAASLGEF
EQSRPIIEKIKEDYPQYKILLTFFSPSGYEVRKDYPLADIVCYLPFDKKRNVKKFLQLIQ
PKMAIFVKYEFWYNFVNQLYKGGIPVYMVSAIFRPSQIFFKWYGGMMRRMLGYYECLCVQ
DEGSEKLLASIGITNVKVCGDTRFDRVLEIREQAKPLSIVEYFARKAKEENEKIFVAGSS
WPKDEDIIIPYFNNTTDLKLIIAPHEIDEAHLKYIESNLQRPHIRYSQAIPEMMGDYDCL
IIDSYGLLSSIYRYGHIAYVGGGFGVGIHNLLEAAVYDIPVVFGPNFKKFREAKQLLERG
GGYSISDYQSFRGLIDEFLQYEGTLDSAGQHAGDYVRSNSGVVARVMDVLNL

Enzyme Prediction     

No EC number prediction in MGYG000003338_00834.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	45	206	1.8e-47	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1519	KdtA	1.13e-69	1	411	2	416	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
PRK05749	PRK05749	7.03e-65	1	410	3	417	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
pfam04413	Glycos_transf_N	1.28e-58	49	206	15	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
COG4588	AcfC	0.004	6	127	13	130	Accessory colonization factor AcfC, contains ABC-type periplasmic domain [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53581.1	2.40e-211	4	412	2	410
QIK59050.1	2.78e-210	4	412	2	410
AST55039.1	4.96e-175	4	412	2	410
QUR47587.1	4.96e-175	4	412	2	410
QCY57442.1	4.96e-175	4	412	2	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	3.54e-30	50	379	43	344	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66663	1.36e-29	50	379	22	323	3-deoxy-D-manno-octulosonic acid transferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=kdtA PE=1 SV=1
Q8R6G8	8.44e-29	17	376	12	373	Bifunctional glycosyltransferase/methyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) OX=190304 GN=trmB PE=3 SV=1
P0CE14	1.73e-26	50	410	58	422	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=waaA PE=3 SV=1
Q3KMF4	2.36e-26	50	410	58	422	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) OX=315277 GN=waaA PE=3 SV=1
P0AC76	3.02e-26	50	410	51	416	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999417	0.000597	0.000006	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003338_00834.