CAZyme Information: MGYG000003338_00999

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas
• CAZyme ID: MGYG000003338_00999
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000003338_317|CGC1	45276	5.1561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003338	3210940	MAG	United States	North America

• Gene Location: Start: 8877; End: 10061 Strand: +

Full Sequence      

MKQKYSLLFALIGILFANCTDVDDVPGLYPVYEEVKELSIVDKNATAETKALYSNLWAIQ
SKGFMFGHHDDLWYGRKWYNEAGRSDTKDVCGDYPAVFSFDVSEIMDDRYQNEANLIRRR
VAIEAYDRGEVLTACMHLNNPKTGGDSWDNSSNEVVKEILTEGHETNIKFKLWLDRLADF
ALNLKGSDGKLIPILFRPFHEHTQTWSWWGSSCTTQDEFISLWKFTINYLRDTKEVHNFI
YAISPQIDSAMGRENFLFRWPGNDYVDFLGMDSYHGLSPTIFTTNMNTLSNLSKELKKPC
GVTETGVEGIQRNGVPEKNYWTQQILTPATGQFISMIVMWRNEYNPSESGNHFYSVFKGH
ASENSFKKMYNSPISFFSADLPNMYEMAEGLTVK

Enzyme Prediction     

No EC number prediction in MGYG000003338_00999.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	41	373	7.6e-63	0.9735973597359736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.06e-31	41	274	1	230	Glycosyl hydrolase family 26.
COG4124	ManB2	6.68e-15	121	309	117	299	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72560.1	4.75e-253	1	394	1	394
QRM99613.1	4.75e-253	1	394	1	394
CBK67266.1	4.75e-253	1	394	1	394
QUT31668.1	1.93e-252	1	394	1	394
ALJ60278.1	1.05e-183	1	394	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	1.58e-77	46	387	9	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	9.79e-68	39	385	32	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	9.79e-68	39	385	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	1.80e-67	39	385	55	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	7.61e-67	39	385	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	5.60e-44	3	342	14	362	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.28e-34	38	372	40	389	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	5.26e-13	34	306	25	294	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
G2Q4H7	1.48e-11	39	306	173	424	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	6.60e-09	42	306	148	408	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003338_00999.