CAZyme Information: MGYG000003338_01031

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas
• CAZyme ID: MGYG000003338_01031
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		34011.62	4.1572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003338	3210940	MAG	United States	North America

• Gene Location: Start: 4564; End: 5469 Strand: -

Full Sequence      

MPGDWSGNVQMTDDASIQSFTNAKEGDIVRVTIKDVAAGAQGSFKGSDWSEIAAGYDYFD
ISGSYYEMTLTEDIVTKLKSSGLIIGGHDYTATGVYLIPANSSGDYAFYRNQTYFDATNA
TIEGTFENEVFKSDMAKVATSLKQLQDAGIAVIWRPFHEAAGGWFWWGKDAESCKKMWIA
MFDYFKTEGVNNLIWVWTSEDDDNDWYPGDAYVDIIGRDLYNKDVAACKLAYDTEFDRYG
HKIIALTENGSVGLISEQWASGARWAWFMPWYGTEHATNEWWQDAMNQDYVITRDQLPNL
K

Enzyme Prediction     

EC	3.2.1.151	3.2.1.73	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	99	296	2.8e-64	0.6765676567656765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.50e-32	99	281	101	289	Glycosyl hydrolase family 26.
COG4124	ManB2	8.72e-16	131	224	160	259	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89672.1	3.85e-142	1	301	253	558
ALJ59270.1	3.85e-142	1	301	253	558
QMI79428.1	5.47e-141	1	301	254	565
BBK85892.1	1.10e-140	1	301	254	565
QUT62087.1	1.10e-140	1	301	254	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	5.32e-65	54	301	98	360	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	1.89e-57	98	297	109	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	4.25e-54	98	297	200	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3WDQ_A	2.76e-41	113	298	156	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	2.85e-31	57	297	196	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55298	1.21e-38	100	299	258	461	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	1.23e-38	100	299	260	463	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55296	1.49e-36	100	299	259	462	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P49425	4.34e-34	106	299	259	459	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	2.98e-29	57	297	225	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000016	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003338_01031.