CAZyme Information: MGYG000003344_01297

Basic Information

• Species: Dialister sp900538805
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900538805
• CAZyme ID: MGYG000003344_01297
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198		22433.68	5.6558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003344	2547672	MAG	China	Asia

• Gene Location: Start: 3954; End: 4550 Strand: +

Full Sequence      

MRIALKRRKKEVQRHQGNTGAMVFTLLTALLCVLFLFLVDNIRFLKPSEQVSHIIVQCAS
EEQISPSLLEAVILTESKFNEKAVSHVGAVGMMQLMPDTARWISEQSGLPSDNLASPEQN
IPLGAWYLNYLLEEYHNNEVFALAAYNAGRGNVDEWIEKNHWPEGFSDMDKIPFPETREF
VKSVVSARDRLEAEKKGT

Enzyme Prediction     

No EC number prediction in MGYG000003344_01297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	61	191	8.9e-31	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	6.92e-73	54	190	7	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.71e-53	54	186	9	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.26e-44	66	187	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.02e-35	64	166	10	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	3.37e-30	48	184	136	276	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24355.1	9.25e-102	1	196	1	196
AOH39655.1	1.60e-65	17	194	13	189
AXL22000.1	3.55e-45	50	185	41	179
CCC73618.1	3.84e-45	50	185	9	147
AVO73570.1	1.01e-44	50	185	41	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	1.58e-20	41	186	413	554	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.58e-20	41	186	409	550	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.59e-20	41	186	419	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.59e-20	41	186	423	564	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.60e-20	41	186	429	570	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.97e-20	57	186	66	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	9.00e-20	62	186	491	620	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	3.07e-19	60	186	489	620	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.07e-19	60	186	489	620	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O64046	6.67e-17	48	186	1419	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	39