CAZyme Information: MGYG000003346_00711

Basic Information

• Species: Prevotella sp900554545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554545
• CAZyme ID: MGYG000003346_00711
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000003346_23|CGC1	35882.6	7.8586

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003346	3265104	MAG	China	Asia

• Gene Location: Start: 162069; End: 163037 Strand: +

Full Sequence      

MKKFFISLLAFACSLAANAASKYDNPDTLFVARDGTGQFRTVGEAVEVCRAFMEYHKVIY
VKNGVYKEKIIIPSWLTNIEICGESADKTIITYDDHANIRLPETGKPMGTFRTYTVKVEG
SDITFKNITIENNAAKLGQAVAIHTEGDRLTFTGCRLLGNQDTVYTGVGGTRVYFNNCYI
EGTTDFIFGPSTAWFEDCTIHSKANSYVTAASTPQDVAFGYVFNHCRLTAAPGVDKVYLG
RPWRPYAYTLFMNCDLGAHIVPAGWHNWKNPKNEQTARYLEYNNTGAGAKTAERVGWSKQ
LTKKEAAQVTVENVFNGWEVNK

Enzyme Prediction     

No EC number prediction in MGYG000003346_00711.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	316	3.5e-103	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	4.17e-79	29	308	7	289	pectinesterase
pfam01095	Pectinesterase	2.01e-73	31	317	4	297	Pectinesterase.
PLN02682	PLN02682	2.30e-69	28	306	70	352	pectinesterase family protein
PLN02432	PLN02432	1.80e-64	31	317	15	288	putative pectinesterase
COG4677	PemB	6.48e-62	5	318	53	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	1.70e-178	1	322	1	324
ADE82952.1	1.70e-178	1	322	1	324
BCS84477.1	2.20e-177	1	315	1	315
AGB28242.1	1.19e-169	1	316	1	316
QQY41711.1	8.17e-161	18	315	15	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	8.97e-45	31	308	11	294	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	4.51e-43	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.46e-42	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	1.18e-39	31	297	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	9.64e-31	39	318	18	337	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	6.40e-56	31	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.52e-54	28	316	272	565	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q42608	2.51e-52	28	316	259	552	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8VYZ3	3.25e-52	33	306	90	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q5MFV6	3.33e-51	28	316	276	569	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000804	0.808954	0.189373	0.000365	0.000263	0.000233

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003346_00711.