CAZyme Information: MGYG000003346_01163

Basic Information

• Species: Prevotella sp900554545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554545
• CAZyme ID: MGYG000003346_01163
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	MGYG000003346_36|CGC1	68075.11	7.4404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003346	3265104	MAG	China	Asia

• Gene Location: Start: 6246; End: 8075 Strand: -

Full Sequence      

MRIKMLLPVVAAAMTLAVKAYGGEAVRPFAPGEVRLLPSRFHDNFERDSAWIMSIPAKSL
LHSFRNTAGVFSGHEGGYDSVEKLGGWESLDCDLRGHITGHIMSALANLYAQTGSTAVKA
KADSIVAGLDEVQRAYGTGYLSAFGQGLIDRNIQGKSVWAPWYTLHKILQGLIDQYTLCH
NDTALAVAKRMGEWAYGKTHALGDDVRRRMLRNEFGGFNDAMYQLYQITGDGRFLETARF
FYHNEKIDPLKAGNADLGTAHANTFIPKLLGECRNYDLTGSEESRRAAELLFRTLSQEHA
FVTGEVSDKEHLFPPSEQYKHLTGYDGENCCTFNLLKLASKVFSWNADKAAADYMERAIF
NHILGQQDPQTGMVTYFTPLLTGAYRLYSTPMNSFWCCVGSGFESHVGYASYIYFHTDNA
LYVNLFIPSEVTWGGTTVRQETDFPRSGAVTLTVGGEAKEFAMHLRRPWWAVSMAVRVNG
KRVKLGKGDAVLKRKWRSGDRVEVTYGMELREEAVNGDPSRVALMYGPVVMAGCLGHVDS
PFSDPTKHNDYYTFDYQVPASAAEKARIKGASELEKTGPLTFKTRQGVEVKPFYDVHHER
YVVYWNKTE

Enzyme Prediction     

No EC number prediction in MGYG000003346_01163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	33	532	1.1e-173	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.33e-175	33	532	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.40e-104	34	545	12	514	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	2.29e-06	557	605	28	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00179.1	2.98e-230	26	606	43	637
QUT34119.1	2.98e-230	26	606	43	637
ALJ42763.1	1.70e-229	26	606	44	638
BCA49451.1	1.70e-229	26	606	44	638
QUT70398.1	1.70e-229	26	606	44	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	3.47e-88	19	608	18	651	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	7.18e-85	19	608	18	651	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	3.15e-21	221	540	197	566	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.62e-19	221	540	197	566	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.91e-17	152	543	125	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000385	0.998921	0.000175	0.000191	0.000158	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003346_01163.