CAZyme Information: MGYG000003346_01178

Basic Information

• Species: Prevotella sp900554545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554545
• CAZyme ID: MGYG000003346_01178
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158	MGYG000003346_36|CGC2	18532.63	6.0798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003346	3265104	MAG	China	Asia

• Gene Location: Start: 35886; End: 36362 Strand: -

Full Sequence      

MYDRLVNHHKLNNLIWVWTSQTSADDGVADSTWYPGDEYVDVVGRDSYYALQYPLMKEYN
ALSSMFPGKLVTLAECGNGDEVRMSPWSKIWRQGSRWCWFMTWYDYNYNAGQSQEHKYAG
KDWWTDAFNSGTVLDRDAFRQLRGGSHKYVLVKDNQVL

Enzyme Prediction     

EC	3.2.1.151	3.2.1.4	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	1	137	1.2e-29	0.39933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.28e-17	1	106	186	285	Glycosyl hydrolase family 26.
COG4124	ManB2	1.31e-04	1	48	212	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX62597.1	3.02e-33	1	143	311	449
QIK58757.1	4.62e-32	11	143	336	456
ARK08557.1	4.62e-32	11	143	336	456
QIK53340.1	4.63e-31	11	143	336	456
QRQ58989.1	1.04e-27	11	136	232	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	4.25e-29	11	136	232	353	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	8.25e-25	11	141	213	336	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	4.09e-24	11	141	304	427	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
6Q75_A	9.27e-16	1	117	201	313	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	1.99e-15	2	137	226	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	1.70e-17	1	105	336	431	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	3.20e-13	1	105	355	447	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	3.15e-12	1	103	226	319	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55297	8.49e-11	1	149	341	471	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	8.49e-11	1	149	339	469	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003346_01178.