CAZyme Information: MGYG000003346_01584

Basic Information

• Species: Prevotella sp900554545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554545
• CAZyme ID: MGYG000003346_01584
• CAZy Family: GH67
• CAZyme Description: Extracellular xylan exo-alpha-(1->2)-glucuronosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641	MGYG000003346_46|CGC1	72977.39	6.4694

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003346	3265104	MAG	China	Asia

• Gene Location: Start: 1695; End: 3620 Strand: -

Full Sequence      

MIQLRIMSALAAATFCLASNAEDGSLLWLDMQRMTHTERIKTNDNSAVAKNAVNELTAYW
HGGDVTLKKDGKMPDNDGFAIEKAAKNGEIIIKARRSAGLMYGAYELLRMQQTSGVIAEE
HSEPDFEYRILNHWDNPDGSVERGYAGKSIWKWEEINGDKGTMSIDLKERLTTYARANAS
IGINGSVLNNVNASPSILTIEYIKKVKVIADLLRPYGIKTYLSVNFASPMVLDGLKTADP
LDNEVRAWWKKKAKEIYREIPDFGGFLVKANSEGQPGPGDYNRTHADGANMLAEALAPHK
GIVMWRSFVYGNHEGEDRVKQAVTEFNGLDGKFAKNVILQSKNGPLDFQPREPYAPIFDQ
MKQTPLWAELQITQEYLGQSRHLVYLAPMWKEFFKFVNPKQLRGIAGVANTGDDANWCGH
HFSQANWYAFGRLAWNSELSSDSIAREWLEQTFTHEAAFVNPMTEVMEASREACVDYMMP
LGLHHIFKADHHYGPEPQGSYPKFPIEWCPVYYHKADTAGIGFDRTSSGTDAVSQYRHPY
DSIYNSLESCPEEYLLWFHHVSWNYKMKNGKTLWQNLCAHYDRGVSEAERFAAVWQTMRP
YVDDERFAHVSRLMKEQVDNAKEWRNICLGYFSSFSRQIIE

Enzyme Prediction     

EC	3.2.1.139	3.2.1.131	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH67	67	638	2.7e-250	0.8759342301943199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3661	AguA2	0.0	77	632	94	667	Alpha-glucuronidase [Carbohydrate transport and metabolism].
pfam07488	Glyco_hydro_67M	0.0	107	416	1	324	Glycosyl hydrolase family 67 middle domain. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
pfam07477	Glyco_hydro_67C	1.67e-124	418	641	1	219	Glycosyl hydrolase family 67 C-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C terminal region of alpha-glucuronidase which is mainly alpha-helical. It wraps around the catalytic domain (pfam07488), making additional interactions both with the N-terminal domain (pfam03648) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34756.1	0.0	7	640	6	641
QNT67391.1	5.16e-295	19	640	18	666
BCS85458.1	4.67e-283	16	641	14	627
AGB29054.1	1.50e-272	19	641	17	648
ADI70674.1	1.80e-266	16	641	14	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQI_A	2.64e-187	77	634	95	665	Structureof Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQI_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQJ_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQJ_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQK_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQK_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQL_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus],1GQL_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus]
1H41_A	2.11e-186	77	634	95	665	Pseudomonascellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus],1H41_B Pseudomonas cellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus]
1MQP_A	3.14e-158	70	632	82	663	TheCrystal Structure Of Alpha-D-Glucuronidase From Bacillus Stearothermophilus T-6 [Geobacillus stearothermophilus]
1K9D_A	6.27e-158	70	632	82	663	The1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1 [Geobacillus stearothermophilus],1L8N_A The 1.5A crystal structure of alpha-D-glucuronidase from Bacillus stearothermophilus T-1, complexed with 4-O-methyl-glucuronic acid and xylotriose [Geobacillus stearothermophilus],1MQQ_A THE CRYSTAL STRUCTURE OF ALPHA-D-GLUCURONIDASE FROM BACILLUS STEAROTHERMOPHILUS T-1 COMPLEXED WITH GLUCURONIC ACID [Geobacillus stearothermophilus]
1MQR_A	8.86e-158	70	632	82	663	ChainA, ALPHA-D-GLUCURONIDASE [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3PC73	3.10e-186	77	634	119	689	Extracellular xylan exo-alpha-(1->2)-glucuronosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=gla67A PE=1 SV=1
Q09LY5	1.72e-157	70	632	82	663	Xylan alpha-(1->2)-glucuronosidase OS=Geobacillus stearothermophilus OX=1422 GN=aguA PE=1 SV=1
P96105	3.71e-155	77	632	86	658	Xylan alpha-(1->2)-glucuronosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aguA PE=1 SV=2
Q5AQZ4	9.16e-137	37	632	75	687	Alpha-glucuronidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aguA PE=1 SV=1
A1DD80	7.69e-133	75	636	111	684	Probable alpha-glucuronidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aguA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000713	0.998419	0.000275	0.000204	0.000177	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003346_01584.