CAZyme Information: MGYG000003346_02007

Basic Information

• Species: Prevotella sp900554545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554545
• CAZyme ID: MGYG000003346_02007
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42527.41	6.1858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003346	3265104	MAG	China	Asia

• Gene Location: Start: 14566; End: 15681 Strand: -

Full Sequence      

MKRLFIVLSALIAGITIQAQKYLGGDISLLPTYRQNGTEYKTQDGKTTCPYKIFKQSEWN
AMRVRLFVDPANAPQDNKDEGVCQDLSYVVSLCKQIKEHGFKLMLDFHYSDTWADPGKQF
TPHAWAKAIEGKSRDEQIRMLTDSVYSHTRTALETLKKENAMPDFIQVGNEITFGTLWPT
GKVDPVKDDNWDTLLTFLRAGVKACREVCPKAQIIIHTEHAQDWLATEGYYDKLKKGKLD
YDVIGLSYYPMWHGTIKHLGVVLDSIKTEFNKPVMIVEAAFYYSHKNDKWEPDPNRYAEL
YPISAEGQRKFTEELVTMLNSHDNVTGLFWWFPEENESGATVVKSWLNRGLFDNETGKAL
PALDELSKFIE

Enzyme Prediction     

No EC number prediction in MGYG000003346_02007.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	23	364	1.1e-95	0.9883040935672515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	4.10e-94	22	364	1	331	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	4.33e-71	24	363	42	388	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT66820.1	3.01e-148	20	371	23	365
QVJ80245.1	3.46e-107	1	369	4	375
ADE83762.1	4.21e-101	1	369	4	368
AGB28452.1	1.42e-97	2	370	5	368
VEH14955.1	7.98e-97	21	371	47	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	1.42e-47	24	363	53	388	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJS_A	6.80e-42	19	363	1	326	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1R8L_A	1.11e-38	24	333	27	322	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
4BF7_A	1.64e-38	22	333	21	315	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
2GFT_A	8.01e-38	24	333	27	322	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	9.85e-59	23	371	8	351	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q4WJ80	3.15e-42	22	333	25	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
A1D3T4	4.41e-42	22	333	25	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
B0XPR3	4.41e-42	22	333	25	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
P83692	3.72e-41	19	363	1	326	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000544	0.998585	0.000222	0.000205	0.000190	0.000180

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003346_02007.