CAZyme Information: MGYG000003346_02106

Basic Information

• Species: Prevotella sp900554545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554545
• CAZyme ID: MGYG000003346_02106
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000003346_65|CGC2	42063.71	7.5698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003346	3265104	MAG	China	Asia

• Gene Location: Start: 44509; End: 45627 Strand: -

Full Sequence      

MKIKTMAAMLAMAFLTASTAQAQGGKNDGGIMTKKWSSVAPKLADDFFTTAEAARIGDNL
LFYQHPTGGWPKNLQLQDELTPALKKEIEKKKQGKRYATIDNKGTTTEIAYLARLYNATG
TEKYRDAAIKGFGYLFEAQYDNGGWPQFYPLSKGYYTHITYNDDAMVNVLKLMRDAAKGK
EPYAFLPDSVKAKAQASLDKGIDCILKTQVVQNGVKTVWCAQHDENTLQPANARAFELAS
LSGQESDDIALFLMSLSKPSDEIRQCIEDAVAWFKKSKITGKRIEKFTNADGKKDYRIVD
CAQDDAPCETLWARFYTLDDNRPFFCDRDGVMKFDISEIGYERRNGYSWYNDDGLEVLKR
YEKWEEKYGMGK

Enzyme Prediction     

No EC number prediction in MGYG000003346_02106.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	64	354	2.3e-119	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	1.42e-147	64	358	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	7.36e-140	64	358	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48738.1	1.34e-156	34	369	32	367
QUT45489.1	1.34e-156	34	369	32	367
QUT78007.1	3.34e-156	34	367	32	361
AVM53205.1	2.67e-152	34	366	34	366
QDO69049.1	8.47e-152	34	368	32	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.09e-73	47	367	77	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	1.71e-61	50	358	30	323	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	2.65e-60	50	358	30	323	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000233	0.999025	0.000191	0.000204	0.000169	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003346_02106.