CAZyme Information: MGYG000003346_02536

Basic Information

• Species: Prevotella sp900554545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554545
• CAZyme ID: MGYG000003346_02536
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	MGYG000003346_85|CGC1	87990.55	6.7421

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003346	3265104	MAG	China	Asia

• Gene Location: Start: 200; End: 2557 Strand: -

Full Sequence      

MKRTVAFLSLLLGFVFSCHAEAIERKQNFDFDWKFILDDNSAYSGSAVDESAWSGVQLPH
DWSTTLAWDPTVSGSAAHLPGGIGWYRKTFDVPSSYKGKCISILFDGIYHQSDVYVNGRH
LGFRPYGFCSIEYDLTPYIVFGGKNVIAVRVDRKEKQDVCRWYTGSGIYRHAWLIVRNPV
HIPTYGTYVTTPRVTEAQADVDIVTTLANKSGKQQSVTVTQRIIDASGKTVAKSKILKRS
LAAGDSVDVKQTLAIGNPILWSQDNPYLYVMETTVKAGGKTVDTYRTTFGVRTFKFDPER
GFMLNGKQVKLKGLCLHQDMGVLGTAVPDRGYEYRLEILKEYGCNAIRCAHNQPSPELLD
LCDRMGLLVIDEAFDKWKSGYYAKYFDDWWQRDLADMILRDRNHPSIILWSIGNEVQEAW
DEGNEGIERAKMLNDFVHKLEPTRPTTLAGQNNHNGKFSAVVDVTGYNYLEARLLADRAK
NPTHCYFISEELPYFQGAEGNIRAYLTDNPWNTVAAHDFIAGGFIWSGVDYWGEAGGDSN
GWPNGLFDMAMTEKPRAVFHRAMWNPGKPVVGIAVMDNSLDIDHGRDLWQWPLMASHWSF
PPRYRGLMMVVRTTTNCERVELVCNDKQMGVYTTADFPNNTIEWNVPFNPGTIVANAYNG
DSLVASSRLVTAYKAEAFAAKADRTRLKADGQDLSFIRIGLQDKDGNPVEVDDRNITVTV
EGDGVMRGIDTGETRRKALLTAGTVKSYFGRAQAVVQSTRKAGTMYVRVRVEGIDGEKVI
AIDTE

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	20	553	1.7e-126	0.601063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.08e-65	24	531	10	502	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.48e-45	85	448	68	447	beta-D-glucuronidase; Provisional
PRK10340	ebgA	7.31e-44	80	544	109	572	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	4.70e-29	84	415	122	462	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	1.96e-27	33	175	8	166	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48869.1	0.0	1	784	1	785
QJR79164.1	0.0	21	782	12	773
QRQ58661.1	0.0	1	785	1	786
SCV06580.1	0.0	1	785	1	786
QUT25652.1	0.0	1	785	1	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RSK_A	9.18e-164	20	774	1	768	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6B6L_A	2.61e-162	20	774	1	768	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
4YPJ_A	3.99e-150	24	777	7	801	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T9A_A	9.13e-148	22	767	25	829	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	3.93e-144	25	784	2	802	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.87e-162	12	785	30	849	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.72e-96	8	672	32	708	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	1.80e-66	28	728	30	742	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	7.54e-66	28	785	7	739	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	4.43e-57	1	674	20	721	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000788	0.800878	0.197339	0.000406	0.000299	0.000270

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003346_02536.