CAZyme Information: MGYG000003347_00233

Basic Information

• Species: Prevotella sp900765465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900765465
• CAZyme ID: MGYG000003347_00233
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		29247.02	9.008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003347	2095533	MAG	China	Asia

• Gene Location: Start: 16; End: 798 Strand: +

Full Sequence      

MEQIHAKYPKIKICGSSGPSADGKDFDYGWEQMRKLGVDMVDEHYYKSPEWFRSNASRYD
KYDRKGPKVFAGEYAAHAKHDPNSWEAALSEAAFMTGLERNADVVYQATYAPLFAHVEGW
QWRPDLIWFDNLTSVRSANYYVQQLYGLNKGTNVLKLTENGKPVAGEKGLYASACFDKAT
KSYIVKIANTSNEAKEINVTFNGIKKLNPGKVTVLHADNIQAENKIDNKNVVVPVVSDAQ
ANGNVLNVKMKPNSFVVYRF

Enzyme Prediction     

EC	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	3	259	1e-48	0.4222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06964	Alpha-L-AF_C	3.30e-49	72	254	1	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
smart00813	Alpha-L-AF_C	9.71e-43	72	254	1	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67029.1	7.12e-179	1	260	387	646
BCS85009.1	4.71e-129	1	260	377	643
VEH14843.1	2.52e-122	1	260	386	652
AGB28487.1	2.08e-118	1	260	387	653
ADQ78503.1	3.28e-111	1	259	389	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	2.50e-28	4	197	370	562	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	1.77e-49	4	170	398	565	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
B8NKA3	1.03e-25	2	241	387	609	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2
Q9SG80	1.09e-25	2	255	404	650	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q2U790	1.40e-25	2	241	387	609	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2
Q0CTV2	1.62e-24	41	242	418	609	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003347_00233.